KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_0811Help
Entry
Clst_0811         CDS       T02527                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:csd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Clst_0811
  Lipid metabolism
   00561 Glycerolipid metabolism
    Clst_0811
   00600 Sphingolipid metabolism
    Clst_0811
Enzymes [BR:csd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Clst_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(891425..892813)
Genome map
AA seq 462 aa AA seqDB search
MRRIGDKVTDIKIAYIGGGSMGWAWNLMSDLANEEQLSGTVRLYDIDKEAAARNEKIGNS
LKNHPNAKSQWDYIAVDTLEEALKGADFVIISILPGTFDEMESDVHLPEKYGIYQSVGDT
VGPGGHVRALRTIPMFVEFANAIKQWAPEAWVINYTNPMTLCVRTLYEAFPEIKAFGCCH
EVFGTQELLKSALADIEGIQAGHRRDIKVNVIGINHFTWLDKATYEGRDLFPIYKKFVDK
YYETGFEGTKKGHWMNDFFASANRVKFDLFKRYGIIAAAGDRHLAEFCPPWYLKDPETVR
SWMFGLTPVSWRKENLKKRRAKSERLVNGEEPFELKQSGEEGVLQIKALCGLGELVTNVN
LPNRGQIANLPIGVVVETNAVFSHNSVRPVQAGSLPPDVLNLVFRHVINQETTLKAALKK
DKELGFRAFANDPLVTISINDAWKLYNDMLRNTKKYLPGWDI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaatcggtgacaaggtcacggacattaaaatcgcatatataggcggcggctca
atgggttgggcgtggaatctgatgagcgacctggcaaacgaggaacagctgtcaggtacc
gtcagactttatgatattgataaagaagcagccgcaaggaacgaaaaaatcggtaattcc
cttaagaaccatcctaatgcgaaaagtcagtgggattatatagcagtggacactttggag
gaggcattaaaaggtgccgatttcgtgattatttccatcctgcccggaacatttgatgaa
atggaatccgacgtgcatcttcccgaaaaatacgggatttatcagtcggtgggagacacg
gtaggtccaggcggccatgtccgcgcccttcgtacgataccgatgtttgtggaatttgcc
aatgccattaaacaatgggcgcctgaagcatgggtaattaattacaccaatcctatgaca
ctgtgtgtccgcacactgtacgaggctttccccgagattaaggctttcggttgctgccat
gaagttttcggaacacaggagcttttgaaatcggctcttgctgatattgaaggaattcag
gccggtcacagaagagatatcaaggtgaacgttattggaattaaccattttacatggctg
gataaagccacatacgagggtcgtgatctgttcccgatttacaaaaaatttgtcgacaaa
tactatgaaacaggctttgaaggaaccaagaaaggtcactggatgaacgatttctttgca
tcggcaaaccgcgtaaaatttgatctgtttaaacgctatggaattatagctgccgcgggg
gacagacacctggcagaattctgcccgccgtggtatctgaaagacccagaaacagtaaga
tcatggatgtttggtttaaccccggtaagctggagaaaggaaaaccttaagaaaagaaga
gcaaagagcgaacgtctggtaaacggtgaggaaccatttgaacttaagcaaagcggcgaa
gaaggagtgcttcagatcaaagccctctgcggtctgggagaactggtcaccaacgttaac
cttccaaacagaggtcagatagccaacctgccgattggagtggtagtggaaaccaacgcg
gtgttcagtcacaactccgtacgtcccgtccaggccggaagtctgcctcccgatgtactg
aaccttgttttcaggcatgtcatcaatcaggaaacaacgctcaaggccgcattaaagaaa
gacaaggaacttggcttcagggcatttgccaacgatcctctggttacaataagcataaac
gacgcatggaagctttataacgatatgttacggaatacaaagaaatacctgcccggctgg
gatatctga

DBGET integrated database retrieval system