KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_0877Help
Entry
Clst_0877         CDS       T02527                                 

Gene name
xyi
Definition
Xyi (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clst_0877 (xyi)
   00051 Fructose and mannose metabolism
    Clst_0877 (xyi)
Enzymes [BR:csd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Clst_0877 (xyi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
975457..976782
Genome map
AA seq 441 aa AA seqDB search
MSEFFKNIPKIKYEGPKSDNPLAFKFYNPDEVIGGKTMKEHLRFSVAYWHTLQGRGSDPF
GLDGTAIRPWDNITDPMDLARAKVDAIFEFCEKLDVPFFCFHDRDIAPEADNLRETNRRL
DEIVARIKDRMKDSNVKLLWGTTNAFGHRRFTHGAATSNNAAVFAYAAAQVKKAMEITKE
LGGQNYVFWGGREGYETLLNTDMKLELDNFARFLRMAVDYKKEIGFDGQLLIEPKPKEPT
KHQYDFDAATVIGFLKMHGLDKDFKLNIEANHATLAGHTFQHDLRVARIHDMLGSIDANQ
GDLLLGWDTDQFPTNIYETTLAMMEVIKMGGFTKGGLNFDAKVRRGSFEPVDLFYGHIAG
MDAFALGFKVAYKIVQDGIFDKFIEERYASFRTGIGKDIVEGKVGFKELEAYVLEHGEPE
ITSGRQEMLEAILNQYILGVR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattttttaaaaacataccgaaaataaaatacgaaggccccaaatctgacaat
cctctggcatttaagttttacaaccccgacgaagtaatcggcggaaaaacgatgaaggag
cacctccgtttttcggtggcatactggcatacattacagggaagaggcagcgatcctttc
gggttggacggcacggcaataagaccatgggataacattaccgatccgatggatttggca
agggcaaaagttgacgctatcttcgaattttgtgagaagctcgatgtgccgttcttctgt
ttccatgacagggatatagctcctgaagccgacaacctcagggaaacaaacagacgtctt
gatgagattgtggcccgcataaaggacagaatgaaggacagtaatgtcaaactactttgg
ggtaccacgaatgctttcggccacagacgctttacccatggtgcggcaacatcaaacaac
gctgcggtttttgcctatgcagcggcccaggttaagaaagccatggaaattacaaaggaa
ctcggcggtcaaaactatgtattctggggtggccgtgaaggatatgaaacactgctgaat
accgacatgaaactcgaacttgacaattttgcccgtttcctgcgcatggccgttgattac
aagaaggaaatcgggtttgacggacagctgctgattgagcccaagccaaaagaacccaca
aagcatcagtatgactttgatgctgcgacggttataggattcctgaaaatgcacggcctt
gacaaggacttcaaactgaacattgaagcaaaccatgcaactcttgcaggccatactttc
cagcatgatttacgcgtggcaaggatccatgacatgctcggcagtatagatgccaatcag
ggtgacctgcttctcggctgggataccgaccaattcccgacaaacatttatgaaacaacg
ctggctatgatggaagtcattaaaatgggaggatttacgaaaggcggtctgaactttgac
gcgaaggtaagaagaggatcctttgagcccgttgacctgttctatggccatatagccggt
atggacgcatttgcccttgggttcaaggtggcttataagattgtgcaggacggaattttc
gacaagtttattgaagagcgttatgcaagcttcagaacgggtatcggtaaggacattgta
gagggtaaagtagggttcaaggagcttgaggcgtatgtccttgaacacggcgaacctgaa
attacgtcaggaagacaggaaatgctggaagcaatactcaaccagtatatccttggtgta
agataa

DBGET integrated database retrieval system