KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_1812Help
Entry
Clst_1812         CDS       T02527                                 

Gene name
adhE
Definition
AdhE (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:csd01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:csd00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:csd00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:csd00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:csd00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:csd00350]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:csd00625]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:csd00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2056529..2059246)
Genome map
AA seq 905 aa AA seqDB search
MENKERKIVDSVDALKKVIARVREAQRKFSTYSQEQVDEIFKAAATAANQARIPLAKMAV
EETGMGVVEDKVIKNHYAAEYVYNTYKNVRTCGVLEEDKAYGIKKIAEPVGVIAAVIPTT
NPTSTAIFKTLIALKTRNAVIISPHPRAKKCTIAAAKIVLDAAVAAGAPEGIIDWIDVPN
IELTNLLMKEADIILATGGPGMVKAAYSSGKPAIGVGPGNTPAVIDESADVVLAVNSIIH
SKTFDNGMICASEQSVIVHKNVYDAVKAEFAARGCYFLKEDEIEKVRKTIFVNGALNAQI
VGQPAYKIAELAGVKVPVGTKILIGEVDSTDPSEEFAHEKLSPVLAMYKAEDIHDAFEKA
ERLVANGGYGHTAAIYLDVTTEQAKIDEFASRLKTCRILVNTPSSQGAIGDIYNFKLAPS
LTLGCGSWGGNSVSENVGVKHLLNIKTVVERRENMLWFRAPEKIYIKKGCLPVALNELKY
VMGKKRAFIVTGSFLYHNGYTKPITDRLDELGIEHTTFFDVLPDPTLSCAKAGAEQMRAF
QPDTIIAFGGGSAMDAAKIMWVMYEHPEVDFMDMAMRFMDIRKRVYTFPKMGEKAYFVAI
PTSAGTGSEVTPFAVITDEKSGVKYPLADYELLPDMAIIDVDFHMSAPKGLTAAAGIDAL
THALEAYVSLMATDFTDGLAKQALQMIFKYLPRAYDNGQTDVEAREKMANAATIAGMAFA
NAFLGVCHSMAHKLGAFYHLPHGIANALMIEEVIRFNASEAPAKMGTFPQYGYPHALRRY
AEIAEALNLGGENDHEKLENLIKAINDLKARVGIKSSIKEYGINEKEFLERLDEMVEQAF
DDQCTGTNPRYPLMSEIRQMYLNAYYGKKHFVDEEKPNEADIAGTEDENKVKKAYLRARV
GAKRA
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaagaaagaaagattgtagacagtgtggacgcgttaaagaaagtcattgcc
cgggtaagggaagcgcaaaggaaattttcaacctattcccaggaacaggtggatgaaatt
tttaaggctgctgccactgccgcaaaccaggcaagaattccgctggcgaaaatggcggtg
gaagaaaccggtatgggcgttgtggaagataaagttataaaaaaccactatgccgccgaa
tatgtttacaatacgtataagaacgtaagaacctgcggggttttggaagaagataaggca
tacggtatcaaaaaaattgccgagcctgtcggtgtgattgccgctgttattcctaccact
aaccctacttccacggcaatttttaaaaccctgatcgcgctgaaaacacgcaatgccgtt
attatcagcccacatccgagagctaaaaaatgcaccatcgctgcggcaaaaatcgtattg
gatgctgccgttgccgcgggggctccggaagggattattgactggattgatgtgccgaac
attgagttgaccaatctgcttatgaaagaagcagacattatccttgccacaggtggtccc
ggtatggtgaaggcggcttattcctccgggaaaccggctatcggtgtcgggcctggcaat
actccggccgttattgatgaaagcgccgacgttgtccttgccgtgaactccattattcat
tccaaaacgtttgataatggtatgatttgcgcatcagaacaatcggtaattgttcacaag
aatgtttatgacgctgtaaaagctgaatttgcggcccgtggatgctatttccttaaagaa
gatgaaattgaaaaggtacgcaagacgatttttgtcaacggcgcgttaaatgcccagatt
gttggtcagccggcatacaaaattgccgaacttgccggtgtgaaagtgcctgtaggcaca
aaaatcctcatcggagaagttgacagcacagacccgtcggaagaatttgcccatgaaaag
ctgtcacctgtccttgcgatgtataaagctgaggatattcatgacgcttttgagaaagcc
gaacgtttggttgccaacggaggttacggtcataccgcagcaatttatttggatgtaacc
accgaacaggctaaaattgacgaattcgcttcgcgtttgaagacctgccgtatacttgtg
aatactccgtcttctcagggagctatcggcgacatttacaactttaagcttgcgccgtcg
ttaactcttggctgtggttcctggggcggaaattcggtttccgaaaatgttggggtaaaa
cacctgcttaatatcaaaacggttgttgaaagaagggaaaatatgctgtggttccgcgct
cccgaaaaaatatacatcaaaaagggatgtttgccggtagcccttaatgagttgaaatac
gtcatgggtaagaaacgcgcttttatagttaccggcagcttcctctatcacaatggttac
acaaagcccattaccgacagacttgacgaactgggcattgaacatacaacgttttttgat
gttttacccgatccgacgctttcctgcgcaaaagcgggagctgagcagatgagagccttc
cagcccgataccattattgccttcggtggcggatctgcgatggacgccgcgaaaatcatg
tgggtaatgtatgagcatcccgaagttgatttcatggacatggctatgcgttttatggat
atcaggaaaagggtttatacatttccgaaaatgggagaaaaggcgtattttgttgcaata
ccgacttctgcgggtaccggatccgaagtaactccttttgcggttatcaccgacgaaaag
agtggagtaaaatatcccctcgcagactacgagttgctccccgacatggcaattatagat
gtggattttcacatgagtgctcccaagggccttaccgccgcagcaggtatagatgccctc
acccatgcgcttgaggcgtacgtttctcttatggccactgattttaccgacggactggcg
aaacaggctctgcagatgatttttaaatacctgccccgcgcctatgataacggtcagacc
gatgtggaagcacgtgaaaaaatggctaatgccgccaccattgcaggtatggcgtttgca
aatgctttccttggtgtttgccattccatggcacataagctgggcgctttttatcatttg
cctcatggtattgccaacgcgcttatgatagaagaagtaatccgtttcaacgcttcggaa
gcaccggccaaaatgggaactttcccgcaatacggatacccgcacgctttaagacgttat
gccgaaattgctgaggcgcttaatctcggcggcgaaaacgatcatgaaaagctggaaaat
ctcattaaagccattaatgatctgaaggcaagggtggggatcaagtcatcaatcaaagag
tatggcataaatgagaaggaattcctggaacgcctcgacgagatggttgaacaggcattc
gacgaccagtgcaccggtaccaatccgcgatatccgctgatgagcgaaataaggcaaatg
tatctgaatgcttattacggcaaaaaacattttgtcgatgaagaaaagccaaatgaagcg
gatatcgccgggacagaggatgaaaacaaagttaaaaaggcgtatctgagagccagagtc
ggagcgaagagagcatga

DBGET integrated database retrieval system