KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_1886Help
Entry
Clst_1886         CDS       T02527                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
csd00730  Thiamine metabolism
csd00790  Folate biosynthesis
csd01100  Metabolic pathways
csd02020  Two-component system
Module
csd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:csd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Clst_1886
   00790 Folate biosynthesis
    Clst_1886
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Clst_1886
Enzymes [BR:csd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Clst_1886
Exosome [BR:csd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clst_1886
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:csd00537]
 Enzymes
  Clst_1886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase T4_Gp59_N
Motif
Other DBs
NCBI-ProteinID: AGI39927
UniProt: L7VL95
Position
complement(2142251..2143783)
Genome map
AA seq 510 aa AA seqDB search
MKNHWKKIASVIFAVLFIASVFSVLLGGGSNAETFQSRNKTALTGVITASRKAPKYIFLF
IGDGMSYPQIQTASYYLGAKSSDGEVVAVPLSFMKFPVTGVAETYDSSSFAPDSSSTATS
IATGNKTYSGVINMDTTYTKKFEAISEKLKKQLGYKIGIITSVNLNHATPAAFYAHQPSR
SNYYEIGLEMIESGFDFFAGGALISPNGEKGDQKSLYDIAREKGYKVVTKQKDAEKLSAN
DGKTIVISETLADYDSISYEIDAKDGEWRLADYVRKGIEMLYNDTGFFMMVEGGKIDWAC
HANDAATVIHDTIALSNAVEVAVEFYNKHPEDTLILVTGDHETGGLSIGFAGTDYDTFLT
NLSNQKISYAKFDTDYVAGYKKNNTKFSDVLTDIEENFGLVPKYKAKSDTNPNLILTDYE
YEKLYEAYRRTIDGYRQLNEEEYILYGTYEPLTVTITHILNNKSGINFSSYAHTGLPVPV
FAVGNGAELFEGYYDNTDIYFKLAKLTSVK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcactggaaaaaaattgcgtcggtcatttttgcggttttgttcattgcatcg
gtgttttcggtgctgttaggcggcggcagtaatgctgaaacctttcaaagccgtaataaa
acagcattaactggagtgataactgcaagccggaaagcgccgaaatacatattcctgttt
atcggggatggcatgagttatcctcagatacaaactgcatcctattatcttggcgcaaag
tcaagtgacggcgaagtggtcgctgtgcctctaagctttatgaaatttcccgttacaggc
gtggccgaaacatatgacagttcttcatttgcccccgactcgtcgtcaacggcaacatcc
attgctaccggaaataaaacgtacagtggcgttatcaatatggataccacatatacaaaa
aagtttgaagccatttcagagaagttaaaaaagcagttgggatataaaatcggcatcatt
acgtctgtcaacttaaaccacgcgaccccggcggcgttctacgcgcaccagccttccagg
agcaattattatgaaataggtctggaaatgattgaaagcggttttgacttcttcgcggga
ggtgcgctgatcagcccgaacggggaaaagggtgatcagaaaagcctgtatgatatagcg
agggaaaaaggatacaaagtggtaacaaagcagaaagatgccgaaaaattaagcgctaat
gacggaaagacaattgttatatccgaaaccctcgctgactacgattcaatttcatatgag
attgacgcgaaagacggggagtggaggcttgcagactatgtaagaaaaggcattgagatg
ctttacaatgatacgggtttctttatgatggtggaaggcggaaagattgactgggcgtgt
cacgctaacgatgcggcgacggtaatacatgacacaattgcgttaagcaatgcggttgaa
gtggcggtggaattttacaataagcatcctgaagatactctgatactggttaccggcgat
catgaaacaggcggtctttcaataggttttgccggaacggattatgatacgttcttaacc
aatctttccaatcagaaaatatcttatgccaaatttgatactgattatgtcgccgggtat
aagaaaaacaacacgaaattttccgatgttttaacggatattgaagagaattttggactt
gtacccaaatataaagccaaatcagatacaaaccccaatttaattctgaccgactatgag
tatgagaaattgtatgaggcgtacaggaggaccattgacgggtacagacagctgaacgag
gaagaatatatactttatgggacttatgagccgctgaccgttaccattactcatatacta
aacaacaaatcgggcattaactttagttcctatgcccataccggacttccggtgcctgtt
tttgccgttggaaacggagccgagctttttgaaggttattatgataacactgacatatat
tttaaactggcaaaacttacttcggtaaaataa

DBGET integrated database retrieval system