KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_2162Help
Entry
Clst_2162         CDS       T02527                                 

Definition
maltooligosyl trehalose synthase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:csd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clst_2162
Enzymes [BR:csd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Clst_2162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2445042..2446754)
Genome map
AA seq 570 aa AA seqDB search
MNKAPCNKINAGPMFNAYPDSLGGTLSDILKFLQMDELKNVFQSFYILPSIFNTDLDRGF
SVIDYELNEQLATAEDLEKLKNLNIELKLDFVLNHLSVLSHQFRDILKKGENSEYKDFFI
DWNKFWEGCGRMTGEGYIMPEEDLIENMFFRKPGLPILFVRFPDGREVPYWNTFYQEVRY
DKLDAIDLVYALDIQYPTAQKLTDRINAEISSGKKPKEIDFGEFSRYKDKVVDLLESRRK
YLGQMDLNVRSPKVWEFYEETLGKLSRYGAKIVRLDAFAYVSKKPGLRNFFNEPETWELL
EKIKEIADKYGLVLLPEIHSKYEEKIHEKLAEKGYLTYDFFLPGLIIDALERHTGEYLVK
WFRELQEKEIRVVNMLGCHDGIPLLDLKGLLPDRYIDKLIDTLVKRGGYIKDLHGRKNMY
YQVNCTYYSALGENDKKMLLARAIQIFMPGKPQVWYLDLFAGKNDYEAIKRGHKEINRTN
LTWEQIYEGMKKKIVRQQLSLLRFRNTFPAFDFDSKITVDNTDEQILIINWVKDGNIANL
VADLATYDFSIKAINNEGVNVFSFSSNDRD
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcgccttgtaataaaattaatgccggacccatgtttaatgcatatcctgac
agtctgggcggaacgttatcggacatacttaagtttcttcaaatggatgaacttaaaaac
gtatttcagtctttttacatacttcccagtatttttaacaccgatttggatcgcggtttt
tcggtcattgactatgaacttaatgaacaactggcaacggctgaggacctggagaaactc
aaaaatttaaatattgagctgaaacttgattttgttctgaatcatttgtcggtgctttcg
catcagttcagggatattttgaaaaaaggtgaaaattctgaatacaaagatttctttatt
gactggaacaagttctgggaaggctgcggccgaatgaccggtgaaggctatataatgcct
gaagaggatttgatagaaaacatgtttttcagaaaacctgggcttcccattctcttcgtc
aggtttcctgacggcagggaagttccttactggaatacgttttatcaggaagtaagatac
gataaactggatgcaatagatctggtatacgccttggatattcagtatcctacggctcag
aagctgacggacagaataaacgccgaaatttcttcggggaaaaaaccaaaagagatcgat
ttcggagaattttcacgttataaggacaaagtggttgatttattggaatcaaggcggaaa
taccttggacaaatggatttaaacgttcggtctccgaaagtatgggaattctatgaggaa
acactgggtaaattatcccggtacggtgcaaaaattgtaagacttgacgcatttgcctat
gtatccaaaaaaccggggcttagaaatttcttcaatgagcccgaaacgtgggagctcctg
gaaaaaataaaggaaattgcagacaaatacggacttgtgcttttgcccgaaattcattca
aaatatgaggaaaaaatacatgaaaagcttgccgagaaaggatatctgacctatgacttt
ttcctgcctgggcttattatagatgctctggagaggcataccggcgaatatttggtaaag
tggttcagagaattacaggaaaaggaaataagggttgtcaatatgctcggatgtcatgac
ggaattccgcttttggatttaaaaggcctattgcccgaccggtatatagataaactgatt
gatacgcttgtaaaacgcggtggttatataaaagatctgcacggaagaaaaaatatgtat
taccaggttaactgcacgtactacagcgccctgggtgaaaacgacaaaaagatgctgctg
gcgagggccattcagatttttatgcctggtaaacctcaggtgtggtacctggacctgttt
gcaggcaaaaatgattatgaagccataaaacgggggcataaggaaattaaccggacgaac
ctcacatgggaacagatttatgagggcatgaagaaaaagatagtaaggcagcagctgtca
ttattgagattcagaaatacattccctgcttttgattttgattcaaagattactgttgac
aataccgatgaacagattctgataataaattgggttaaagacggaaatattgctaatctt
gtagccgatttggcgacttacgatttcagtataaaagccataaacaacgagggtgttaac
gttttttcattcagttcaaatgatagggattag

DBGET integrated database retrieval system