KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_2377Help
Entry
Clst_2377         CDS       T02527                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
csd00340  Histidine metabolism
csd01100  Metabolic pathways
csd01110  Biosynthesis of secondary metabolites
csd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csd00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Clst_2377
Enzymes [BR:csd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Clst_2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Glyco_hydro_67N YcbB
Motif
Other DBs
NCBI-ProteinID: AGI40399
UniProt: L7VS10
Position
complement(2671525..2672820)
Genome map
AA seq 431 aa AA seqDB search
MKVYSSAECDINLLVKTLRTREGTARPDVAGTVADIINTVREKGDKALFEFTERFDGVSV
KSLEVGREQIKKAFESLEPELAAAIEKACENITAFHQKQRENSWFESFDNGIFVGQKITP
LERVGVYVPGGTAPLPSSVLMNVIPAKVAGVSEVIMCTPPGRNGMPSPVILACAYLTGVD
RVFSVGGAQAVAAMAYGTETIPRVDKITGPGNIYVATAKKMVYGVCDIDMIAGPSEILVI
ADEYANPAYVAADLLSQAEHDVLASAIFITNSENLIRNVMTEMDRQLRKLSRKEIITKST
ENYGAAVLVESIEEAVKLSNLIAPEHLELMVKDPFSLLGSIKNAGAIFLGEYAPEPLGDY
MAGPNHILPTNGTARFSSPLSVNDFVKKSSVISYSEKALKSIYKDIIRFAETEGLDAHAN
SVRIRFEGENK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttattcttccgcagaatgtgatattaatttgttggtaaaaacattaagaacg
cgggaaggcaccgcacgacccgatgtggccgggacggtggccgacataataaatacggtg
agggaaaagggagataaagccctttttgagttcaccgaaagatttgacggagtatccgtg
aaaagccttgaagttggaagggaacaaataaaaaaagctttcgaatcccttgagccggag
cttgccgccgcaatagaaaaagcatgtgaaaatataacggcatttcatcaaaaacaaagg
gaaaattcctggtttgaaagttttgacaacgggattttcgtcgggcagaaaataacgccc
cttgaacgggtcggggtatacgttcccggaggtacggctccccttccgtcatcggttctt
atgaacgttattccggcgaaagtggcaggggtaagtgaggtaataatgtgtactcctccc
gggaggaacggaatgcccagtcccgtaatactggcgtgtgcgtatctgactggcgtcgac
agggttttcagcgtcggcggcgcccaagcggtggctgcaatggcttacgggaccgaaacc
ataccacgggtggacaagataacagggccggggaacatttacgttgccactgcgaaaaaa
atggtatacggtgtatgtgatatagacatgattgcaggacccagtgaaatacttgtaata
gccgacgaatatgcgaatcctgcgtatgtcgcggcagatttactgtcacaggcagagcat
gatgtactggcgtcggcaatattcattacaaacagcgagaatctaatacgaaatgtcatg
accgaaatggacaggcagcttcggaaactttccagaaaggagatcatcaccaaatccact
gaaaattacggtgcggccgttcttgttgaatcaatcgaagaagcagttaagctttcaaac
cttatcgcccccgaacaccttgagctgatggtgaaagatcccttttcgcttttggggagt
ataaaaaatgcaggggcgattttccttggcgaatatgcgcctgaacccctgggcgattat
atggccgggccgaatcatattctgccgacaaacggtacggcaaggttctcgtcgcccctt
tcggtaaatgattttgtcaaaaaatcaagtgtgatttcgtattccgaaaaggcgctgaaa
agcatatacaaagacatcatacgctttgctgaaaccgaagggcttgacgcccatgccaat
tcggtacgtataaggtttgagggggagaataaatga

DBGET integrated database retrieval system