KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_2461Help
Entry
Clst_2461         CDS       T02527                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:csd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clst_2461
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Clst_2461
Enzymes [BR:csd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Clst_2461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2765513..2766328
Genome map
AA seq 271 aa AA seqDB search
MEELRREYLKNVKRIVIKVGTSTLTHETGRINLLRMDRLAMTISELINEGYEVILVSSGA
IGVGMGKLSLKERPQVMGMKQALAAIGQCELMNIYSKMFASYNQIVAQILLTKNDVDDDI
KKRNIENTFEHLLEKHVLPIVNENDTVSTDEISSMDHFGDNDTLSAVVAKLVNADLLIIL
SDINGFYDSDPRENKNSKLIDTVTEIDDRVMRCAGGEGTKLGTGGMVTKLNAAKIVINAG
IHMVLANGCDPFIIFDILRGEKIGTFFVAKR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctcaggcgggaatacctgaaaaacgtaaaacgtattgtaattaaggtcggt
acctccaccctaacgcatgaaacggggcggattaacctcttaagaatggacaggctcgcg
atgacaatttcagagctgataaacgagggatatgaggtaatccttgtatcctcgggcgcg
atcggagtgggcatgggcaaactgagcctgaaggaacggcctcaggtaatgggtatgaaa
caggcccttgcagccataggccagtgcgaactgatgaatatttacagcaaaatgtttgct
tcatacaaccagatagttgcgcagattttgcttacaaaaaacgatgtggatgacgatata
aaaaaaaggaacattgaaaatacttttgaacacctgctggaaaaacacgtgcttccgatt
gtcaatgagaacgataccgtttcgaccgacgaaataagctcaatggatcacttcggggac
aacgatacgttgtccgccgtcgtggcgaaactggtaaacgccgacctgctgattattctt
tcggatataaacgggttttatgactcggatccgagggaaaacaaaaactcaaagctgata
gacaccgtaaccgaaatagatgaccgcgtaatgcggtgcgcgggcggcgaaggcactaaa
ttgggcaccgggggcatggtaacaaagctgaacgccgcgaaaatagtcataaacgcggga
atacatatggtgctggcaaacggctgcgatccgtttatcatttttgatatcctgcgcggc
gaaaaaatcggaacttttttcgtcgcaaaaagataa

DBGET integrated database retrieval system