KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_2537Help
Entry
Clst_2537         CDS       T02527                                 

Definition
pectin methylesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clst_2537
   00500 Starch and sucrose metabolism
    Clst_2537
Enzymes [BR:csd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Clst_2537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2821521..2822498)
Genome map
AA seq 325 aa AA seqDB search
MIVAADGSGDYLSLGQALQALENMKDSGERVVIHIKKGIYREKLHISRPNVTLIGEDAES
TVITYDDYARKRFENGEEYGTFNSYTVLITGDGFEARNLTIENAAGSGTIKGQALAAYVD
ADRAVFRNCRFLGHQDTLFTAPLPPAPIIKNGFKGPGEHRERKMQSHYYENCYIEGDVDF
IFGSATAVFKNCTIVSLDRGEPEGGVNGYITAASTPEGVKYGYVFINCRLLGKCKPSTVY
LGRPWRNFARTVFINCYMDDHIKSEGWHNWDKPESESTVFYAEYNSYGPGARPDKRVQWA
KILTDEEAKEYTIEKILPWLSGRQE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgcagcggacggaagcggagattatctttcgctgggacaggccttgcaggca
ctggaaaatatgaaagacagcggcgaaagagttgtaattcatattaagaaaggaatatac
agggagaaacttcacataagcaggcccaatgtcacactgattggggaagacgccgaatca
acggtgattacttacgacgactatgcaaggaagaggtttgaaaacggcgaagaatacggt
acgtttaattcatataccgttcttattactggcgacggatttgaagcgcgcaacctgact
attgaaaacgcggcaggatcgggtacaataaagggacaagcccttgcagcttacgtggat
gccgaccgtgcagtgttccggaactgccgttttttggggcatcaggatactctcttcaca
gcaccgctgcccccggcgcctattataaaaaacggatttaaagggccgggtgagcacaga
gaaagaaaaatgcagagtcactattatgaaaactgctatattgaaggcgatgtggatttt
atattcggctcggcaacagcggttttcaagaactgtactattgtgtcgctggacaggggt
gaaccagaaggcggcgtaaacggatatattacggccgcgtccacgcctgaaggcgtgaaa
tacggttatgtttttattaactgcaggcttctgggcaaatgcaaaccgtccaccgtgtat
ctcggcagaccgtggaggaattttgcgagaaccgtttttataaattgctatatggatgat
catattaaaagtgaaggctggcataactgggataaacctgaaagcgaatccaccgttttt
tatgccgagtataacagctacgggcccggggcccggcccgataaaagggttcagtgggca
aaaatacttaccgatgaagaggcaaaggaatataccattgaaaaaatcctgccgtggctg
agcggcagacaggaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system