KEGG   Caulobacter segnis: Cseg_0064Help
Entry
Cseg_0064         CDS       T01221                                 

Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cse  Caulobacter segnis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cseg_0064
Enzymes [BR:cse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cseg_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
69699..70385
Genome map
AA seq 228 aa AA seqDB search
MAKGAPVWITRAHPGAEATAAKVAALGFTPVVDPLLAVAPIAASVDLSGIAAVAFTSVNG
VQAFSKLAGARDLPVFTVGRATASAASEAGFSSVSSADGDVADLARLIAAARPGPVLWAG
AREPAGDLVAMLNDAGVAARGVAIYETVDRPPSEATLALLDRPLTVLLHSPRAARVLAEI
LRRRPASALRTLCLSEAVAAPLEALAERGSVAFAPRPDETALLSLLTA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagggcgcgccggtctggatcacccgcgcccatcccggcgccgaggccaccgcc
gcaaaggtggcggcgctcggcttcacgccggtcgtggatcctttgctggcggtcgcgccg
atcgccgcgtcggtcgatctttccgggatcgccgctgtggccttcaccagcgtcaacggc
gtccaggcgttctcgaagcttgccggagcgcgggacctgccggtcttcaccgtgggccgc
gccaccgcctctgcggcgagcgaggcgggcttctccagtgtctccagcgccgacggcgat
gtcgcggatctggcgcgcctgatcgcggccgcccgtccggggcccgtcctgtgggccggc
gcccgggagcccgcgggcgatcttgtggcgatgttgaacgacgccggtgtcgccgcgcgc
ggcgtggcgatctacgagacggttgatcgtccgccgtccgaagcgacgctggccttgctg
gatcggcccctgaccgtgctcctgcactcgccgcgggcggcgcgcgtcctggccgagatt
ctgagacgtcggcccgcctccgccttgcgaacgctctgcctttccgaggcggtcgcggcg
cctttggaagcgctcgccgaacgcggctctgtggcgttcgcgccgcgcccggacgaaacc
gcgctgctctccctgctcacagcttaa

DBGET integrated database retrieval system