KEGG   Caulobacter segnis: Cseg_0141Help
Entry
Cseg_0141         CDS       T01221                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cse  Caulobacter segnis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cseg_0141
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cseg_0141
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cseg_0141
Enzymes [BR:cse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cseg_0141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
156920..158140
Genome map
AA seq 406 aa AA seqDB search
MNAPAKPNDYSAYPDANGRFGDFGGRYVAETLMPLVLDLGKAYAEAKADPEFQAQLTSYN
THYAGRPSPLYFAERLTEHFGGAKIYFKRDELNHTGSHKINNALGQILLAMRMGKTRIIA
ETGAGQHGVATATVCARFGLPCVVYMGATDVERQKPNVFRMNLLGAEVRPVTSGTGTLKD
AMNEAMRDWVTNVHDTYYLIGTAAGPHPYPVMVRDFQSVIGAEAREQILEMEGRLPDAVV
ACIGGGSNAIGLFHPFLNDASVRLIGVEAAGHGVSTDKHAASLTGGRPGVLHGNRTYLLQ
DDDGQIIDAHSISAGLDYPGIGPEHSFLHEVGRAEYVSSTDEEALAAFQLCSTLEGIIPA
LEPAHALARVGEIAQELGKDKIVVMNLCGRGDKDIFTVAEALGRKI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgctcctgcgaaacctaacgactactcggcctatcccgatgcgaacggccgtttc
ggcgacttcggcggccggtacgtggccgagacgctgatgccgctggtgctggacctgggc
aaggcctacgccgaggccaaggccgatcccgagttccaggcccaactgaccagctacaac
acccactacgccggccggcccagcccgctctatttcgccgagcggctgaccgagcacttc
ggcggggccaagatctatttcaagcgcgacgagctgaaccacaccggctcgcacaagatc
aacaacgccctgggccagatcttgctcgccatgcgcatgggcaagacccggatcatcgcc
gagaccggcgcgggccagcacggcgtggccaccgccaccgtctgcgcgcgctttggcctg
ccatgcgtcgtctacatgggcgccaccgacgtcgagcgtcagaagcccaatgtcttccgc
atgaacctgttgggcgcggaagtccgtccggtgacctcgggcacgggcacgttgaaggac
gccatgaacgaggcgatgcgcgattgggtcaccaacgtgcacgacacctactacctgatc
ggcaccgccgccggcccgcacccctatccggtgatggtccgcgacttccagagcgtgatc
ggcgccgaggcgcgcgagcagatcctggagatggaaggccgcctgcccgacgcggtggtc
gcctgcatcggcggcggctcgaacgccatcggcctgttccacccgttcctgaacgacgcc
agcgtgcgcctgatcggcgtcgaggcggccggccacggcgtctccaccgacaagcacgcc
gcctcgctgaccggcgggcgtccgggcgtgctgcatggcaaccgcacctatctgctgcag
gacgacgacggccagatcatcgacgctcactcgatctcggccggtctcgactatccgggc
atcggtcccgagcactcgttcctgcacgaggtcggccgcgccgaatatgtctcgagcacc
gacgaggaggccctggcggccttccagctgtgctcgaccctcgaaggcatcatcccggcg
ctggagccggcccacgccctggcgcgcgtcggcgagatcgcgcaggagctcggcaaggac
aagatcgtggtgatgaatctctgcggtcgcggcgacaaggacatcttcacggtggccgaa
gcgctcgggcgcaagatctag

DBGET integrated database retrieval system