KEGG   Caulobacter segnis: Cseg_0156Help
Entry
Cseg_0156         CDS       T01221                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cse  Caulobacter segnis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cseg_0156
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cseg_0156
   00650 Butanoate metabolism
    Cseg_0156
  Energy metabolism
   00190 Oxidative phosphorylation
    Cseg_0156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
174479..174898
Genome map
AA seq 139 aa AA seqDB search
MSKNDIFQPIQFRTPLSRARGLGSSHHGVSHFITERVSGLALAPLSLWGVYSALKLIGAD
QHTVAAWLGHPLNAVLLLLLLLSALVHLSNAVQVVIEDYVHRFTSKSALVIGNLFVCVLA
GAIGIFSILKVALTVTGAH
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacgacatcttccagcccatccagttccgcacgccgctgtcgcgcgcccgc
ggcctgggctcgtcgcaccacggcgtctcgcacttcatcaccgagcgcgtttcgggcctg
gccctggcgcccctgagcctgtggggcgtctacagcgccctgaagctgatcggcgcggac
cagcacacggtggccgcgtggctcggccacccgctgaacgccgtgctgctgctgcttctg
ctgctgtccgcgctggtgcacctgtcgaacgccgtccaggtggtgatcgaagactatgtc
caccgcttcacgagcaagtcggccctggtgatcggcaatctgttcgtctgcgtgctggct
ggcgccatcgggatcttctcgatcctgaaggtggccctgaccgtgaccggagcccattga

DBGET integrated database retrieval system