KEGG   Caulobacter segnis: Cseg_0398Help
Entry
Cseg_0398         CDS       T01221                                 

Definition
(GenBank) hydroxyacylglutathione hydrolase
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
cse  Caulobacter segnis
Pathway
cse00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cseg_0398
Enzymes [BR:cse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     Cseg_0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAGH_C Lactamase_B
Motif
Other DBs
NCBI-ProteinID: ADG08916
UniProt: D5VE93
Position
complement(404989..405738)
Genome map
AA seq 249 aa AA seqDB search
MPVTIHQFPCLSDNYGFLVRDEASGQVATIDTPDSETILTALDALGWKLDLILNTHWHPD
HAGGNEALKAATGAMIAGPSEVTRIAPVDRALTDGDTVMLGETRFEVLDTGGHTLGHVSY
HAPADGIAFVGDTLFALGCGRLFEGTPEQMWASLSRLTALPDQTTVYCAHEYTASNARFA
LSVDDAPALKARADAVFAARERGEPTVPTTIAAEKATNPFLRAPLLRPNAASPAEAFAEI
RATKDSFKG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcaccatccatcagttcccgtgcctgtccgacaactacggcttcctcgtccgt
gacgaggccagcggccaggtcgcgacgatcgatacgcccgactccgagacgatcctgacg
gcgctcgacgcactgggctggaaactcgacctgatcctcaacacgcactggcacccagac
cacgccggcggcaatgaggccctgaaggcggccacgggcgcgatgatcgccgggccttcg
gaagtcacacggatcgcgccggtggatcgcgcgctcacggacggcgacacggtgatgttg
ggcgagacccgcttcgaggtcctcgacacgggcggccacacgctgggccacgtcagctac
cacgctcccgccgacgggatcgctttcgtcggcgacacgcttttcgccttgggctgcggt
cgcctgttcgaagggacgcccgagcagatgtgggcctcgctgtcacgccttaccgccctg
ccggaccagaccacggtctactgcgcccacgaatacaccgcctcgaacgcgcgcttcgcg
ctgtcggtcgacgacgctcccgcgctgaaggcgcgcgctgacgcggtgttcgccgcgcgc
gagcggggtgagccgaccgtgcccaccaccatcgccgccgagaaggcgaccaatccgttc
ctgcgcgcgcctctgctgcggccgaacgcggcctcgcccgccgaggccttcgccgagatc
cgcgcgaccaaggacagcttcaagggatga

DBGET integrated database retrieval system