KEGG   Caulobacter segnis: Cseg_0494Help
Entry
Cseg_0494         CDS       T01221                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cse  Caulobacter segnis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cseg_0494
   00500 Starch and sucrose metabolism
    Cseg_0494
Enzymes [BR:cse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Cseg_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
527178..528275
Genome map
AA seq 365 aa AA seqDB search
MSPSPPCRRTVLAGAALLAPSLALAAPRYDAVLWRGTGRNPYGAPGYPSLSAAIAAAPAS
GTRPFRILVTRGVWDEQVVIDKPFVELVGEDRRASVISHLAASGLTAPDGKRWGTFRTPT
LFVRAPDFAASNLTIQNAFDGLAEMSKPGGLHSHDGAGPQAVALMLDKGSDRARLREVDI
LGYQDTLFPDAGTSLFERCLITGSYDFIFGAGRALFRQCEIRSRPRPVDPVEGYIVAPST
PIDQPVGFVFHQCRLTKEAGTKPASVYLGRPWRPSSQFSDGRYGDPKYVGMSAFIDCWLD
DHIAPEGWTQMWYTGKDGDPRTMLQPEDARFSQFRLSGPGSAGSFKRGRWLSASEAATLV
SSALR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcgcctccttgccgccgaacggttctggccggcgccgcgttgctggcccca
agtctcgccctggccgcgccgcgctacgacgctgtcctgtggcgcgggacggggcggaac
ccctacggcgcccccggctatccaagcctttcggccgccatcgcggcggctccagccagc
ggaacccgcccgttccggatcctcgtcacgcgcggcgtctgggacgagcaggtggtcatc
gacaagccgttcgtcgagctggtgggcgaggaccgcagggcctcggtcatcagtcacctg
gccgcctcgggcctgacggcgccggacggcaagcgctggggcacgttccgcacgccgacc
ctgttcgtgcgggcgccggacttcgccgccagcaacctcaccatccagaacgccttcgac
ggcctggccgagatgtccaagccgggcggcctgcactcgcacgacggcgcggggcctcaa
gcggtcgcgttgatgctggacaagggctccgaccgcgcacgcctgcgcgaggtggatatt
ctgggctaccaggacaccctgtttcccgacgctggaaccagcctcttcgagcgctgcctg
atcaccggaagctacgacttcatcttcggcgcggggcgggccctcttccgccagtgcgag
atccgctcgcggcctcgcccggtcgatccggtcgaaggctatatcgtcgcccccagcacg
ccgatcgaccagccggtcggctttgtcttccaccagtgccgcctcaccaaggaggcggga
accaagccggcttcggtctatctggggcgcccctggcggccttcgagccagttttccgac
ggccgttacggcgatccgaagtatgtcggcatgtccgccttcatcgactgctggctggac
gaccacatcgctccggaggggtggacccagatgtggtacaccggcaaggacggcgatccg
cgcaccatgctgcagcccgaggacgcgcggttctcacagtttcgcctttcagggccgggg
agcgccggctcctttaagcgtggccgttggttgtccgcgtccgaggcggctactctggtc
tcctccgcccttcggtag

DBGET integrated database retrieval system