KEGG   Caulobacter segnis: Cseg_0494Help
Entry
Cseg_0494         CDS       T01221                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cse  Caulobacter segnis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cse00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cse00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
527178..528275
Genome map
AA seq 365 aa AA seqDB search
MSPSPPCRRTVLAGAALLAPSLALAAPRYDAVLWRGTGRNPYGAPGYPSLSAAIAAAPAS
GTRPFRILVTRGVWDEQVVIDKPFVELVGEDRRASVISHLAASGLTAPDGKRWGTFRTPT
LFVRAPDFAASNLTIQNAFDGLAEMSKPGGLHSHDGAGPQAVALMLDKGSDRARLREVDI
LGYQDTLFPDAGTSLFERCLITGSYDFIFGAGRALFRQCEIRSRPRPVDPVEGYIVAPST
PIDQPVGFVFHQCRLTKEAGTKPASVYLGRPWRPSSQFSDGRYGDPKYVGMSAFIDCWLD
DHIAPEGWTQMWYTGKDGDPRTMLQPEDARFSQFRLSGPGSAGSFKRGRWLSASEAATLV
SSALR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcgcctccttgccgccgaacggttctggccggcgccgcgttgctggcccca
agtctcgccctggccgcgccgcgctacgacgctgtcctgtggcgcgggacggggcggaac
ccctacggcgcccccggctatccaagcctttcggccgccatcgcggcggctccagccagc
ggaacccgcccgttccggatcctcgtcacgcgcggcgtctgggacgagcaggtggtcatc
gacaagccgttcgtcgagctggtgggcgaggaccgcagggcctcggtcatcagtcacctg
gccgcctcgggcctgacggcgccggacggcaagcgctggggcacgttccgcacgccgacc
ctgttcgtgcgggcgccggacttcgccgccagcaacctcaccatccagaacgccttcgac
ggcctggccgagatgtccaagccgggcggcctgcactcgcacgacggcgcggggcctcaa
gcggtcgcgttgatgctggacaagggctccgaccgcgcacgcctgcgcgaggtggatatt
ctgggctaccaggacaccctgtttcccgacgctggaaccagcctcttcgagcgctgcctg
atcaccggaagctacgacttcatcttcggcgcggggcgggccctcttccgccagtgcgag
atccgctcgcggcctcgcccggtcgatccggtcgaaggctatatcgtcgcccccagcacg
ccgatcgaccagccggtcggctttgtcttccaccagtgccgcctcaccaaggaggcggga
accaagccggcttcggtctatctggggcgcccctggcggccttcgagccagttttccgac
ggccgttacggcgatccgaagtatgtcggcatgtccgccttcatcgactgctggctggac
gaccacatcgctccggaggggtggacccagatgtggtacaccggcaaggacggcgatccg
cgcaccatgctgcagcccgaggacgcgcggttctcacagtttcgcctttcagggccgggg
agcgccggctcctttaagcgtggccgttggttgtccgcgtccgaggcggctactctggtc
tcctccgcccttcggtag

DBGET integrated database retrieval system