KEGG   Caulobacter segnis: Cseg_0494Help
Entry
Cseg_0494         CDS       T01221                                 

Definition
(GenBank) Pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
cse  Caulobacter segnis
Pathway
cse00040  Pentose and glucuronate interconversions
cse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cseg_0494
Enzymes [BR:cse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Cseg_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-ProteinID: ADG09008
UniProt: D5VHM7
Position
527178..528275
Genome map
AA seq 365 aa AA seqDB search
MSPSPPCRRTVLAGAALLAPSLALAAPRYDAVLWRGTGRNPYGAPGYPSLSAAIAAAPAS
GTRPFRILVTRGVWDEQVVIDKPFVELVGEDRRASVISHLAASGLTAPDGKRWGTFRTPT
LFVRAPDFAASNLTIQNAFDGLAEMSKPGGLHSHDGAGPQAVALMLDKGSDRARLREVDI
LGYQDTLFPDAGTSLFERCLITGSYDFIFGAGRALFRQCEIRSRPRPVDPVEGYIVAPST
PIDQPVGFVFHQCRLTKEAGTKPASVYLGRPWRPSSQFSDGRYGDPKYVGMSAFIDCWLD
DHIAPEGWTQMWYTGKDGDPRTMLQPEDARFSQFRLSGPGSAGSFKRGRWLSASEAATLV
SSALR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcgcctccttgccgccgaacggttctggccggcgccgcgttgctggcccca
agtctcgccctggccgcgccgcgctacgacgctgtcctgtggcgcgggacggggcggaac
ccctacggcgcccccggctatccaagcctttcggccgccatcgcggcggctccagccagc
ggaacccgcccgttccggatcctcgtcacgcgcggcgtctgggacgagcaggtggtcatc
gacaagccgttcgtcgagctggtgggcgaggaccgcagggcctcggtcatcagtcacctg
gccgcctcgggcctgacggcgccggacggcaagcgctggggcacgttccgcacgccgacc
ctgttcgtgcgggcgccggacttcgccgccagcaacctcaccatccagaacgccttcgac
ggcctggccgagatgtccaagccgggcggcctgcactcgcacgacggcgcggggcctcaa
gcggtcgcgttgatgctggacaagggctccgaccgcgcacgcctgcgcgaggtggatatt
ctgggctaccaggacaccctgtttcccgacgctggaaccagcctcttcgagcgctgcctg
atcaccggaagctacgacttcatcttcggcgcggggcgggccctcttccgccagtgcgag
atccgctcgcggcctcgcccggtcgatccggtcgaaggctatatcgtcgcccccagcacg
ccgatcgaccagccggtcggctttgtcttccaccagtgccgcctcaccaaggaggcggga
accaagccggcttcggtctatctggggcgcccctggcggccttcgagccagttttccgac
ggccgttacggcgatccgaagtatgtcggcatgtccgccttcatcgactgctggctggac
gaccacatcgctccggaggggtggacccagatgtggtacaccggcaaggacggcgatccg
cgcaccatgctgcagcccgaggacgcgcggttctcacagtttcgcctttcagggccgggg
agcgccggctcctttaagcgtggccgttggttgtccgcgtccgaggcggctactctggtc
tcctccgcccttcggtag

DBGET integrated database retrieval system