KEGG   Caulobacter segnis: Cseg_0523Help
Entry
Cseg_0523         CDS       T01221                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cse  Caulobacter segnis
Pathway
cse00790  Folate biosynthesis
cse01100  Metabolic pathways
Module
cse_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cseg_0523
Enzymes [BR:cse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cseg_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADG09035
UniProt: D5VHQ4
Position
complement(562977..563612)
Genome map
AA seq 211 aa AA seqDB search
MDALARERTLIGSDAGLDLEPAERPSREEAMAAVRTLLAWAGDNPEREGLIDTPKRVVDA
FEEWFAGYQGDPAKELSRTFEDVQGYDDMVMLRGIDVQSHCEHHMAPFLGKAWVAYMPTG
KVVGLSKLARLVEIFAKRLQTQETMTMQIADAIEDHLSAAGVAVLIDAEHQCMSTRGVHH
HDVSTITTQFRGVFKTDKVLQQRFMDLVVRK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggacgccctagcccgcgagcgaaccctgatcggcagcgacgccggtcttgatcttgaa
cccgccgagcgcccctcccgcgaggaagccatggccgccgtccggaccctgctggcctgg
gcgggcgacaatccggaacgcgagggcctgatcgatacgcccaagcgcgtcgtcgacgcc
ttcgaggaatggttcgccggctaccagggcgatccggccaaggagctgtcgcgcaccttc
gaggacgtgcagggctatgacgacatggtcatgctgcgcggcatcgacgtgcagagccac
tgcgagcaccacatggcgccgttcctgggcaaggcctgggtcgcctacatgccgaccggc
aaggtcgtgggcctgtccaagctggcgcgcctggtcgagatcttcgccaagcgtctccag
acccaggagaccatgaccatgcagatcgccgacgccatcgaggatcacctctcggccgcc
ggcgtggccgtgctgatcgacgccgagcaccagtgcatgagcacccgcggcgtccaccac
cacgacgtctcgacgatcaccacccagttccgcggcgtcttcaagaccgacaaggtcctg
cagcagcggttcatggacctggtggtgaggaagtag

DBGET integrated database retrieval system