KEGG   Caulobacter segnis: Cseg_0976Help
Entry
Cseg_0976         CDS       T01221                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cse  Caulobacter segnis
Brite
Enzymes [BR:cse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Cseg_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1049646..1050797
Genome map
AA seq 383 aa AA seqDB search
MASNIIDPTRRQALGLAAGAAAGLIAPRAFADETPLRDLAQAKGLYFGSAVPAGPPGATQ
GPFEDARYRAILARECGVLVPENELKWYVVRLAGPEAFDFSRADRIAAFAKENGQALRGH
TLLWHHPQWFPAWTKTYDFGVKPAQAAAKMVTEHIQALCQRYPQMISWDVVNETVDPKDG
SIRSTFLSDAMGKEEVLDLSFHVARQAAPKARLVYNDYMSQEVGNEKHRYGVLKLLEGFR
KRGTPVDALGIQSHIGAENADTFTGFGKPQEKEWTAFLNDVTGMGYDLLVTEFDVHDKGL
PAEFAPRDAAVAAYAKAFLDQVLSYRQTKEVLAWGMIDKYSWLQGQWLREDKKPKRPTLY
DDDYKPKPLREAVAAALRAAPAR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaacatcatcgaccccacgcggcgacaggccttgggtctcgccgccggcgcc
gccgccggcctgatcgcgccccgggccttcgccgacgagactccgctccgcgatctggcc
caggccaaagggctctatttcggctcggcggttccggccggaccgcctggcgcgacgcag
ggtccgttcgaggacgcccgctaccgcgccatcctggcccgcgagtgcggcgtgctggtc
cccgagaacgaactgaagtggtacgtggtccgcctggccgggccggaggccttcgacttc
agccgcgccgaccgcatcgccgccttcgccaaggagaacggccaggccctgcgcggccac
accctgctgtggcaccacccgcaatggttcccggcctggaccaagacctacgacttcggc
gtcaagcccgcccaggcggccgccaagatggtcaccgagcacatccaggccctgtgccag
cgctatccgcagatgatctcgtgggacgtggtcaacgagacggtcgaccccaaggacggc
tcgatccgctcgaccttcctgtccgacgccatgggcaaggaggaggtgctggacctgtcg
ttccacgtcgcccgccaggccgcgcccaaggcccgcctcgtctacaacgactacatgagc
caggaggtcggcaacgagaagcatcgctacggcgtgctcaagctgctggaaggcttcagg
aagcgtgggacgcccgtcgacgccctgggcatccagagccacatcggcgcggagaacgcc
gacaccttcaccggcttcggcaagccgcaggagaaggagtggacggcgttcctgaacgac
gtcaccggcatgggctatgacctgctggtcaccgagttcgacgtccacgacaagggcctg
ccggccgagttcgcgccgcgcgacgcggcggtggcggcctacgccaaggccttcctcgat
caggtgctcagctaccgccagaccaaggaggtcctggcctggggcatgatcgacaagtac
tcgtggctgcaaggccaatggctgcgcgaggacaagaaacccaagcgcccgaccctctac
gacgacgactacaagcccaagcccctgcgcgaggccgtggccgccgcgctgcgggccgcg
ccggcgcggtag

DBGET integrated database retrieval system