KEGG   Caulobacter segnis: Cseg_1395Help
Entry
Cseg_1395         CDS       T01221                                 

Definition
D-cysteine desulfhydrase family pyridoxal phosphate-dependent protein (EC:3.5.99.7)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
cse  Caulobacter segnis
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cseg_1395
Enzymes [BR:cse01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     Cseg_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1501731..1502732)
Genome map
AA seq 333 aa AA seqDB search
MHLARFPRARFAHLPTPLEPLPRLGAALGIDLWVKRDDCTGLAGGGNKTRKLEFLLGEAL
AQGADTLVTQGAVQSNHVRQTIAAGARFGLKTEVILEERTGSKASDYTGNGNVLLDKLMG
AAIRHVPGGSDMVAELESTAESVRQRGGKPYVIPGGGSNTVGALGYVDCARELVVQADQM
DLKIDRLVTATGSAGTHAGLVAGFAALSVDIPILGFGVRAPKPKQEENVFNLAVATAETI
GAAGRVKREAVVADCDYVGEGYGLVDQGVIDALTLAARTEGLLLDPVYSGKAMKGLIDQA
RKGAFKGERVVFLHTGGAQGLFGYQSVLEPALA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcgcccgctttccccgcgctcgtttcgcccatctgccgacgccgctggagcct
ctgccccgcctgggcgcggcgctcgggatcgacctctgggtcaagcgcgacgactgcacg
ggccttgccggcggcggcaacaagacccgcaagctggagttcctgctgggcgaggccctg
gcgcagggcgcggatacgctggtcacccagggcgcggtgcagtccaatcacgtccgccag
accatcgcggccggcgcgcgttttggcctgaagaccgaggtgatcctggaggagcgtacg
ggctccaaggcgtccgactacacgggcaacggcaacgtgctgctggacaagctgatgggc
gcggccatccgccatgtccccggcggcagcgacatggtcgctgaacttgaaagcacggcc
gaaagcgtccgccagcgcggcggcaagccgtacgtgatccccggcggcggctccaacacc
gtcggcgcgctcggctatgtcgactgcgcccgcgagctggtcgtccaggccgatcagatg
gacctgaagatcgaccggctggtcaccgccaccggcagcgccggcacccacgccggcctg
gtcgcgggcttcgcggccctttcggtggacatcccgatcctcggctttggcgtccgggcg
cccaagccgaagcaggaagagaacgtcttcaacctcgccgtcgccacggccgaaacgatc
ggcgcggcaggccgggtcaagcgtgaagccgtcgtggccgactgcgactatgtcggcgaa
ggctatggcttggtcgaccagggcgtgatcgacgccctgaccctggccgcgcgcaccgag
ggcctgctgctcgacccggtctattccggcaaggcgatgaaaggtctgatcgaccaggcg
cgcaaaggcgcgttcaagggcgagcgcgtcgtgttcctgcataccggcggcgcgcagggc
ctgttcggctatcagagcgtgctggaaccggcgctggcctag

DBGET integrated database retrieval system