KEGG   Caulobacter segnis: Cseg_1422Help
Entry
Cseg_1422         CDS       T01221                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cse  Caulobacter segnis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cseg_1422
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Cseg_1422
Enzymes [BR:cse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cseg_1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1529444..1530469
Genome map
AA seq 341 aa AA seqDB search
MGASSAAILGCAGTTLTAEEAAFFRDVKPWGFILFKRNIADPNQVRALTAALRETVGRPD
APILIDQEGGRVARLQPPHWRTYPPGRAYGELVANDPLVAREITRLGARLIAHDLHSLGV
NVDCVPVLDVPDPQGHEIIGDRAYGDTPEQVATLGRAAAEGLLAGGVLPIIKHIPGHGRA
MADSHLELPVVKAKLDELDARDFAPFRVLSDMPMAMTAHVVYTAIDRKNPATTSKKAIKK
IIRDSIGFDGLLMSDDLSMKALSGDFKQRAKDSLSAGCDVVLHCNGDMAEMKAVMSGVGK
MSKEARRRAQAVMNRLVKVPEPFDVAEARARFDAAFDGKYA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctcttccgccgccatcctcggctgcgccgggaccacgttgacggctgaggag
gccgccttcttcagggacgtgaagccctggggcttcatcctcttcaagcgcaacatcgcc
gaccccaaccaggtgcgcgccctcacggccgccctgcgcgaaacggtcggccggcctgac
gcgccgatcctgatcgaccaggagggcggccgcgtcgcccgcctgcagccgccgcactgg
cggacctatccgcccggccgcgcctatggcgagctggtcgccaacgacccgctggtcgcg
cgggagatcacgcgcctcggcgcccgcctgatcgcccacgacctgcattcgctgggcgtc
aacgtcgactgcgtgccggtgctggacgtgccggacccgcaaggccacgagatcatcggc
gaccgcgcctatggcgacacgcccgagcaggtggcgacgctgggccgcgcggcggccgag
ggtctgctggccggcggcgtcctgccgatcatcaagcacatccccggccacggccgcgcg
atggccgacagccacctggagctgccggtcgttaaggccaagctggacgagctggacgcc
cgcgacttcgcgccgttccgggtgctgtccgacatgccgatggcgatgacggcccacgtc
gtctacacggcgatcgaccgcaagaacccggcgaccacctcgaagaaggccatcaagaag
atcatccgcgactccatcggcttcgacgggcttctgatgagcgatgacctgtcgatgaag
gcgctctccggcgacttcaagcagcgcgccaaggacagcctttccgcgggctgcgacgtc
gtcctgcactgcaacggcgacatggccgagatgaaggccgtgatgtcgggcgtcggcaag
atgtccaaggaggcgcgccgccgggcccaggcggtcatgaaccggctggtcaaggttccc
gagcctttcgacgtcgccgaggcccgcgcccgctttgatgcggcgtttgacggaaagtac
gcttga

DBGET integrated database retrieval system