KEGG   Caulobacter segnis: Cseg_1611Help
Entry
Cseg_1611         CDS       T01221                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cse  Caulobacter segnis
Brite
Enzymes [BR:cse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Cseg_1611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1717882..1718454
Genome map
AA seq 190 aa AA seqDB search
MSTDFAAARLNMVESQIRTADVTDLPLQDALRVTPREAVVPAAKAYLAYADTDIEYAPGR
WLLRPREVGKLLQNLKPREGEKALAIAAPYAAAVLENMGLSVTRLEGDDLKAVPGADYDV
IICEGAVAAAPKAWQDALAIGGRLGVVERTGPVGRAIIYLRAEDGVGRRQAFDASPPILA
GFEVEVGFSF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacttcgccgccgcgcggctgaacatggtcgagagccagattcgcaccgcc
gacgtcaccgatctgcccctgcaggacgccctccgtgtgacgccgcgcgaagcggtggtg
cccgccgcgaaggcctacctggcctatgccgacaccgatatcgagtacgcgcccggccgg
tggctgctgcgcccgcgtgaagtgggcaagctgctccagaacctgaagccgcgtgaaggc
gagaaggccctggcgatcgccgcgccctacgccgccgccgtgctggagaacatgggcctc
tcggtcacgcgtctggaaggcgacgacctgaaggccgttccgggcgcggactatgacgtg
atcatttgcgaaggcgccgtcgccgccgcgccgaaggcttggcaggatgcgttggccatt
ggcggccgcctgggcgtggtggagcgcactggcccggtcggtcgcgccatcatctatctt
cgcgccgaggatggcgtgggccgtcgccaggccttcgacgcttcgccgcccatcctggcc
ggtttcgaggtcgaggtcggtttcagtttctga

DBGET integrated database retrieval system