KEGG   Caulobacter segnis: Cseg_1675Help
Entry
Cseg_1675         CDS       T01221                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cse  Caulobacter segnis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cseg_1675
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Cseg_1675
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cseg_1675
Enzymes [BR:cse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Cseg_1675
Exosome [BR:cse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cseg_1675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1782221..1783714
Genome map
AA seq 497 aa AA seqDB search
MIRPFVVALVASVAVPAIALAQLPVSASASDPYYKAGEAALARQLAVVPNTGRAKNVILF
LGDGMGVSTVTAGRIYDGQLKGVDGESNSLAFEKLSYAALSKTYSHDTQVTDSAAGITAI
MTGVKTRNKIIGLTGAAIGEKCETEKGNAVQTLAELAKANGKAAGAVTTTRVTHATPAGA
YAHTAYRDWEGDSDMPVEALQAGCKDIARQLVEAPDALRLDVVMGGGRSRFLPEDKDGKR
ADGRDLTAEWLKAEGTGSAYVTTVDQLKALPADTQHVLGLFASEHLPYEVERPVLEQGVP
TLAEMATTAVDVLSKNPNGYFLLVEGGKIDMGSHLGNAKRTLSETVEFSKAIEAVLAKVD
LKDTLVVVTADHSHGLVISGYAPRNSPILGVSGNEGEPAIAADGKTYTTLMFATGPGGPL
GSDTRADPAKEDLDDVDYHQQAVVNLPSAAHAGEDVGVFADGPQAYLLRGVVEESYIFQV
MRHAFGFDGAAPAGKKR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
ttgatccgccctttcgttgtcgccctggtcgcgtccgtcgccgttcccgccatcgctctg
gcccagcttcccgtttcggccagcgccagcgacccctactacaaggccggcgaggccgcc
ctggcgcgtcagctggccgtggttcccaacaccgggcgcgccaagaacgtcatcctgttc
ctgggcgatggcatgggcgtttcgacggtgacggctggccgcatctatgacggccagttg
aagggtgtcgacggggagtccaattccctggccttcgagaagctgtcctacgcggcgctt
tccaagacctacagccacgacacccaggtcaccgacagcgccgccggcatcacggcgatc
atgaccggcgtgaaaacccgcaacaagatcatcggcctgaccggcgcggcgatcggcgag
aagtgcgagaccgagaagggtaacgcggtccagaccctggccgagctggccaaggccaac
ggcaaggccgccggcgcggtcaccaccacccgcgtgacccacgccaccccagccggcgcc
tacgcccacaccgcctatcgcgactgggagggcgacagcgacatgccggtcgaggcgctg
caggccggctgcaaggacatcgcccggcaactggtggaagcccccgacgccctgcgcctg
gacgtcgtcatgggcggcggtcgctcgcgcttcctgcccgaggacaaggacggcaagcgg
gccgacggtcgtgatctcaccgccgaatggctgaaggccgaagggaccggctcggcctat
gtcaccaccgtcgaccagctgaaggctctcccggccgacacccagcacgtgctgggcctg
ttcgcgtccgagcacctgccttacgaggtcgagcggccggtgctggagcagggcgtgccg
accctggccgagatggcgacgacggccgtcgacgtgctgtccaagaacccgaacggctac
ttcctgctggtcgagggcggcaagatcgacatgggcagccacctgggcaacgccaagcgt
acgctcagcgagaccgtggagttctccaaggccatcgaggccgtgctggccaaggtcgac
ctgaaggacaccctggtggtggtcacggccgaccacagccatggcctggtcatctcgggc
tatgcgccgcgcaattcgccgatcctgggcgtgtccggcaacgagggcgagccggcgatc
gccgccgatggcaagacctacacgaccctgatgttcgccacaggccccggcggcccgctg
ggctccgacacccgcgccgatccggccaaggaagatctcgacgacgtcgactaccaccag
caggcggtcgtgaacctgcccagcgccgcccacgcgggcgaggacgtcggcgtcttcgcc
gatgggccgcaggcctatctgctgcgcggcgtggtcgaggagagctacatcttccaggtc
atgcgccacgcgtttgggtttgacggcgccgcgccggccgggaagaagcgctga

DBGET integrated database retrieval system