KEGG   Caulobacter segnis: Cseg_1675Help
Entry
Cseg_1675         CDS       T01221                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cse  Caulobacter segnis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cse00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cse00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cse02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1782221..1783714
Genome map
AA seq 497 aa AA seqDB search
MIRPFVVALVASVAVPAIALAQLPVSASASDPYYKAGEAALARQLAVVPNTGRAKNVILF
LGDGMGVSTVTAGRIYDGQLKGVDGESNSLAFEKLSYAALSKTYSHDTQVTDSAAGITAI
MTGVKTRNKIIGLTGAAIGEKCETEKGNAVQTLAELAKANGKAAGAVTTTRVTHATPAGA
YAHTAYRDWEGDSDMPVEALQAGCKDIARQLVEAPDALRLDVVMGGGRSRFLPEDKDGKR
ADGRDLTAEWLKAEGTGSAYVTTVDQLKALPADTQHVLGLFASEHLPYEVERPVLEQGVP
TLAEMATTAVDVLSKNPNGYFLLVEGGKIDMGSHLGNAKRTLSETVEFSKAIEAVLAKVD
LKDTLVVVTADHSHGLVISGYAPRNSPILGVSGNEGEPAIAADGKTYTTLMFATGPGGPL
GSDTRADPAKEDLDDVDYHQQAVVNLPSAAHAGEDVGVFADGPQAYLLRGVVEESYIFQV
MRHAFGFDGAAPAGKKR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
ttgatccgccctttcgttgtcgccctggtcgcgtccgtcgccgttcccgccatcgctctg
gcccagcttcccgtttcggccagcgccagcgacccctactacaaggccggcgaggccgcc
ctggcgcgtcagctggccgtggttcccaacaccgggcgcgccaagaacgtcatcctgttc
ctgggcgatggcatgggcgtttcgacggtgacggctggccgcatctatgacggccagttg
aagggtgtcgacggggagtccaattccctggccttcgagaagctgtcctacgcggcgctt
tccaagacctacagccacgacacccaggtcaccgacagcgccgccggcatcacggcgatc
atgaccggcgtgaaaacccgcaacaagatcatcggcctgaccggcgcggcgatcggcgag
aagtgcgagaccgagaagggtaacgcggtccagaccctggccgagctggccaaggccaac
ggcaaggccgccggcgcggtcaccaccacccgcgtgacccacgccaccccagccggcgcc
tacgcccacaccgcctatcgcgactgggagggcgacagcgacatgccggtcgaggcgctg
caggccggctgcaaggacatcgcccggcaactggtggaagcccccgacgccctgcgcctg
gacgtcgtcatgggcggcggtcgctcgcgcttcctgcccgaggacaaggacggcaagcgg
gccgacggtcgtgatctcaccgccgaatggctgaaggccgaagggaccggctcggcctat
gtcaccaccgtcgaccagctgaaggctctcccggccgacacccagcacgtgctgggcctg
ttcgcgtccgagcacctgccttacgaggtcgagcggccggtgctggagcagggcgtgccg
accctggccgagatggcgacgacggccgtcgacgtgctgtccaagaacccgaacggctac
ttcctgctggtcgagggcggcaagatcgacatgggcagccacctgggcaacgccaagcgt
acgctcagcgagaccgtggagttctccaaggccatcgaggccgtgctggccaaggtcgac
ctgaaggacaccctggtggtggtcacggccgaccacagccatggcctggtcatctcgggc
tatgcgccgcgcaattcgccgatcctgggcgtgtccggcaacgagggcgagccggcgatc
gccgccgatggcaagacctacacgaccctgatgttcgccacaggccccggcggcccgctg
ggctccgacacccgcgccgatccggccaaggaagatctcgacgacgtcgactaccaccag
caggcggtcgtgaacctgcccagcgccgcccacgcgggcgaggacgtcggcgtcttcgcc
gatgggccgcaggcctatctgctgcgcggcgtggtcgaggagagctacatcttccaggtc
atgcgccacgcgtttgggtttgacggcgccgcgccggccgggaagaagcgctga

DBGET integrated database retrieval system