KEGG   Caulobacter segnis: Cseg_1825Help
Entry
Cseg_1825         CDS       T01221                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cse  Caulobacter segnis
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cseg_1825
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cseg_1825
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cseg_1825
Enzymes [BR:cse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Cseg_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1969775..1972240)
Genome map
AA seq 821 aa AA seqDB search
MPIDRRTLIHSLPVAGAAIASLAPASGSAGSANSSPRQRIRLDQGWRFALGHAADPDRDF
GFGDFQRTFAKQGRAAGPLALTGYDDSRWREVTLPHDWAVELPFVNNIRFSRNPADKDDE
DLAAAHGYKPIGRNFPETSVGWYRLTLPVSPSDAQGRVALEFDGAFRDATVIVNGYIVTQ
HHGGYASFGVDITEFLNTDGAPDVLLVRLDASLGEGWFYEGAGLYRHVWLVKTTPVFVPQ
WGVFARASRDGQVEVDVEVANRRETGADVRIEALVLDAGAPVASAQAAQSVAAWRDTTAR
LTCKVASPRLWSTDAPNLYVLRVTLREGETVRDVYDVSFGFREFRFDAREGFFLNDRPLK
LKGVNNHQDHAGVGAAIPDALQIWRLKQLKALGANAYRAAHNPPTPELLDACDALGLLVI
DETRQMSSAPEPMDELRRLVRRDRNHPCVMLWSIGNEEPQQGTARGAKIAKAMAREIRDL
DPTRKITAAMNKGYGEGITEAIDVMGFNYHEELIEPFRLKYPDMPIIGTETASAVSTRGE
YARDDKRSVVSSYDVDAPYWGKTAQAWWKLYNAKPYLLGGFVWTGFDYRGEPTPFNWWPS
VSSNFGILDLCGLPKDIFYYYQAWWRDDLPVLHLLPHWNWEGQEGKAVEVWAYTNLDAVE
LFLNGRSLGRQSPPKDGHVQWSVPYAPGRLVAYGFRGGKVVLKSERSTAGTPARLVIETD
RTRLTADGQDVAVINVSVRDKAGVIVPKAAVRVDFDLIGAGRLIGVGNGDPNCHEPDKAD
YRTTYNGWAQALVQTRKAPGDIRLMARAEGLTSAAVALSSR
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgaccgccgaaccctgatccactccctgcccgtcgcgggcgcggcgatcgcc
tcgctggctccagccagcggttcggcgggatcagcaaattcttctccgcgtcagcgcata
cgcttggatcaagggtggcggttcgcccttggccatgccgccgatcctgatcgcgacttc
ggctttggcgactttcagcgcaccttcgccaagcaaggccgcgccgccggccccttggcg
ctcaccggctacgacgacagccgctggcgggaggtcaccctgccccacgactgggcggtg
gagctgccgttcgtcaacaacatccgcttcagccgcaatccggccgacaaggacgacgag
gacctcgccgccgcccacggctataagcctatcgggcggaattttccggagacgtcggtc
ggctggtaccgcttaacgctgcccgtcagcccgtccgacgcccaggggcgcgtggcgctg
gagttcgacggagcgtttcgcgacgccaccgtcatcgtcaacggctacatcgtcacgcag
caccatggcggctacgcctcgttcggcgtcgacatcaccgaattcctgaataccgatggc
gcgcccgacgtgctgcttgtccgcctcgacgccagccttggagaaggctggttctacgag
ggcgccggcctctaccgacacgtctggctcgtaaagacgacccccgttttcgtgccgcaa
tggggcgtcttcgcccgcgcctcgcgcgacggccaggtcgaggtcgacgtcgaagtcgcc
aaccgccgcgagaccggggccgacgtcaggatcgaagcgcttgtgctggacgccggcgcg
ccggtggcttcggcccaggcggcgcaatcggtcgcggcatggcgcgacaccaccgcccgc
ctgacctgcaaggtcgcctcccctcgcctctggtcgacggacgcgcccaatctctacgtc
ctgcgcgtgactctccgcgagggagagacggtccgggatgtgtatgatgtcagcttcggc
ttccgcgagttccggttcgacgcgcgcgaaggcttcttcctcaatgaccgtcccctcaag
ctgaagggcgtcaacaaccaccaggatcacgccggcgtcggtgcggccattccagacgcc
ttgcagatctggcggctcaagcagctgaaggcgctcggcgcgaacgcctatcgcgcggcc
cacaatccgcccacgccggagttgctcgacgcttgcgatgcgctgggtttgctggtgatc
gatgaaacccgtcagatgagctccgcgcccgagcccatggacgagctgcggcgcctggtt
cgccgcgaccgcaatcatccttgcgtgatgctgtggtccatcggcaacgaagaaccccag
cagggcacggcgcgcggcgccaagatcgccaaggcgatggctcgcgagatccgcgacctc
gaccccacccgcaagatcacggccgccatgaacaagggctatggcgaagggatcacggaa
gcgatcgatgtgatgggcttcaactaccacgaagagctcatcgagccctttcggctgaag
tatccggacatgccgatcatcggcaccgagaccgccagcgccgtgtccacccgcggcgag
tacgcgcgggatgacaaacgctccgtcgtctcgtcctatgacgtcgacgcgccctactgg
ggcaagaccgctcaggcttggtggaagctctacaacgccaagccttaccttctcggcggc
ttcgtctggaccgggttcgactatcggggcgagccgacgccgttcaactggtggccgtcc
gtctcttccaacttcggcatactggacctctgcggcctgccgaaggacatcttctactac
taccaggcctggtggagagacgatctgccggtcctgcacctcctgccgcattggaattgg
gagggccaggaaggcaaggccgtcgaggtctgggcgtacaccaaccttgatgcggtcgag
ctgttcctgaacggaagatccctgggccggcaaagcccacccaaggatggccatgtccaa
tggtcggttccctacgcccccggtcgccttgtcgcctatggcttcaggggcggtaaggtc
gtgctgaaatcggagcgaagcaccgccgggacgccggccaggctcgtcatcgagaccgat
cggacgcgtctgaccgccgatggccaggacgtggccgtcatcaacgtgtcggtgcgcgac
aaggcgggcgtcatcgtgccgaaggccgccgtccgggtggacttcgatctcatcggcgcc
gggcgattgatcggcgtcggcaatggcgatccgaattgccacgagcccgacaaggccgac
taccgcaccacctacaacgggtgggcccaggcgctcgtccagacgcgaaaggcgccgggc
gacatccgtctcatggcgcgggcggaaggcctgaccagcgcggccgtcgcgctctcaagc
cgctaa

DBGET integrated database retrieval system