KEGG   Caulobacter segnis: Cseg_1851Help
Entry
Cseg_1851         CDS       T01221                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
cse  Caulobacter segnis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Cseg_1851
Enzymes [BR:cse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Cseg_1851
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Cseg_1851
Lipid biosynthesis proteins [BR:cse01004]
 Fatty acid synthase
  Component type
   Cseg_1851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2005732..2006376
Genome map
AA seq 214 aa AA seqDB search
MSSPAHRFPNRRRFLLGLGLLTQVAAAPKPPVVTVLGDSITAGLGLSARDAMPAQLQAAL
ARRGVSVVVRAAGVSGDTSGGGLARVGFSVAGDTKVCVVALGGNDLLQGVDPAQTKANLR
GVLQRLKARGVSAVLVGVAAPSAIGAAYAREFNAIFPSLAREFNVPLYANILAGVRGDRA
LMQSDGIHPNASGAKRIGEALAPVVARAVRARAT
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcccgcacaccgttttcccaaccgtcgccgatttttgctggggcttggcctg
ctgacgcaggtcgccgccgcgcccaagccgccggtggtgaccgtgctgggcgattccatc
accgccggtcttggcctgtccgcgcgtgacgccatgcccgcccagctgcaggcggcgctc
gcgcggcggggcgtatccgtcgttgtccgtgcggcgggcgtttcgggcgacaccagcggc
ggcggcctggcgcgggtgggcttcagcgtggccggcgacaccaaggtctgcgtcgtggcg
ctgggcggcaacgaccttctgcaaggcgtcgatcccgctcagaccaaggccaatctgcgt
ggcgtgctccagaggctaaaagcgcgaggtgtcagcgcggtcctggtcggcgtcgccgcg
ccgtccgccatcggcgccgcatacgcccgtgagttcaacgcgatctttcccagcctggcg
cgggagttcaacgtgccgctctacgccaacatcctggccggcgtgcgcggtgatcgcgcg
ctcatgcagagcgatgggatccaccccaacgcaagcggcgccaagcgcataggcgaagcc
ctagcgcccgttgtggccagggccgtcagagcgcgcgcgacctaa

DBGET integrated database retrieval system