KEGG   Caulobacter segnis: Cseg_1964Help
Entry
Cseg_1964         CDS       T01221                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cse  Caulobacter segnis
Pathway
cse00071  Fatty acid degradation
cse00280  Valine, leucine and isoleucine degradation
cse00281  Geraniol degradation
cse00310  Lysine degradation
cse00360  Phenylalanine metabolism
cse00362  Benzoate degradation
cse00380  Tryptophan metabolism
cse00410  beta-Alanine metabolism
cse00627  Aminobenzoate degradation
cse00640  Propanoate metabolism
cse00650  Butanoate metabolism
cse00903  Limonene and pinene degradation
cse00930  Caprolactam degradation
cse01100  Metabolic pathways
cse01110  Biosynthesis of secondary metabolites
cse01120  Microbial metabolism in diverse environments
cse01130  Biosynthesis of antibiotics
cse01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cseg_1964
   00650 Butanoate metabolism
    Cseg_1964
  Lipid metabolism
   00071 Fatty acid degradation
    Cseg_1964
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cseg_1964
   00310 Lysine degradation
    Cseg_1964
   00360 Phenylalanine metabolism
    Cseg_1964
   00380 Tryptophan metabolism
    Cseg_1964
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cseg_1964
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cseg_1964
   00281 Geraniol degradation
    Cseg_1964
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cseg_1964
   00627 Aminobenzoate degradation
    Cseg_1964
   00930 Caprolactam degradation
    Cseg_1964
Enzymes [BR:cse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cseg_1964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADG10437
UniProt: D5VGJ4
Position
complement(2137688..2138458)
Genome map
AA seq 256 aa AA seqDB search
MLDVERRGPIAIVTLNRPEAMNALSKALRLALYDAMVALDGDEDVSVVILTGAGERAFTA
GLDLKELGGDASAMGAANDQDARSNPVRAVERCRKPVIGAINGVAITGGFELALACDVLI
ASETARFADTHARVGIMPGWGLSQKLSRLIGPYRAKELSLSGNFLDARTAADWGLVNRVT
APSDLLPTALKLAEDMASIPVETLAFYKGLIDDGYARAFGEALALEHERSSGHNREVTPE
KVEARRRQVMDRGRSQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgtcgaacgacgcggaccgatcgccattgtcaccctgaaccgccccgaggcg
atgaacgcgctctccaaggccctcaggctggcgctttacgacgccatggtggcgctggac
ggcgatgaggacgtcagcgtggtgatcctgaccggcgcgggcgaacgcgccttcacggcg
ggactggacctcaaggagctaggcggcgacgcctcggcgatgggcgccgccaacgaccag
gacgcgcgctcaaatccggtcagggcggtcgagcggtgccgaaagcccgtcatcggcgcg
atcaatggcgtggcgatcacgggtggcttcgaactcgccctcgcctgcgacgtgctgatc
gcctccgagaccgcccgcttcgccgatacccacgctcgggtcgggatcatgcccggctgg
ggactctcacagaagctgtcgcgcctgatcggcccctatcgcgccaaggagctgtcgctc
agcggcaatttcctcgacgcccggacggccgccgactggggcctggtcaatcgcgtcacc
gcgccgagcgatcttctgcccacagccttgaagctcgccgaggacatggcctcgatcccg
gtcgagaccttggccttctacaagggcctgatcgacgacggctatgcgcgcgccttcggc
gaagccctggcgctcgaacacgagcgctcgagcggccacaatcgcgaggtcacgccggaa
aaggtcgaggcgcgccgccgccaggtgatggaccgcggacgctcgcagtag

DBGET integrated database retrieval system