KEGG   Caulobacter segnis: Cseg_1964Help
Entry
Cseg_1964         CDS       T01221                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cse  Caulobacter segnis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Cseg_1964
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cseg_1964
   00650 Butanoate metabolism
    Cseg_1964
  Lipid metabolism
   00071 Fatty acid degradation
    Cseg_1964
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cseg_1964
   00310 Lysine degradation
    Cseg_1964
   00360 Phenylalanine metabolism
    Cseg_1964
   00380 Tryptophan metabolism
    Cseg_1964
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cseg_1964
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cseg_1964
   00281 Geraniol degradation
    Cseg_1964
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cseg_1964
   00627 Aminobenzoate degradation
    Cseg_1964
   00930 Caprolactam degradation
    Cseg_1964
Enzymes [BR:cse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cseg_1964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2137688..2138458)
Genome map
AA seq 256 aa AA seqDB search
MLDVERRGPIAIVTLNRPEAMNALSKALRLALYDAMVALDGDEDVSVVILTGAGERAFTA
GLDLKELGGDASAMGAANDQDARSNPVRAVERCRKPVIGAINGVAITGGFELALACDVLI
ASETARFADTHARVGIMPGWGLSQKLSRLIGPYRAKELSLSGNFLDARTAADWGLVNRVT
APSDLLPTALKLAEDMASIPVETLAFYKGLIDDGYARAFGEALALEHERSSGHNREVTPE
KVEARRRQVMDRGRSQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgtcgaacgacgcggaccgatcgccattgtcaccctgaaccgccccgaggcg
atgaacgcgctctccaaggccctcaggctggcgctttacgacgccatggtggcgctggac
ggcgatgaggacgtcagcgtggtgatcctgaccggcgcgggcgaacgcgccttcacggcg
ggactggacctcaaggagctaggcggcgacgcctcggcgatgggcgccgccaacgaccag
gacgcgcgctcaaatccggtcagggcggtcgagcggtgccgaaagcccgtcatcggcgcg
atcaatggcgtggcgatcacgggtggcttcgaactcgccctcgcctgcgacgtgctgatc
gcctccgagaccgcccgcttcgccgatacccacgctcgggtcgggatcatgcccggctgg
ggactctcacagaagctgtcgcgcctgatcggcccctatcgcgccaaggagctgtcgctc
agcggcaatttcctcgacgcccggacggccgccgactggggcctggtcaatcgcgtcacc
gcgccgagcgatcttctgcccacagccttgaagctcgccgaggacatggcctcgatcccg
gtcgagaccttggccttctacaagggcctgatcgacgacggctatgcgcgcgccttcggc
gaagccctggcgctcgaacacgagcgctcgagcggccacaatcgcgaggtcacgccggaa
aaggtcgaggcgcgccgccgccaggtgatggaccgcggacgctcgcagtag

DBGET integrated database retrieval system