KEGG   Caulobacter segnis: Cseg_2049Help
Entry
Cseg_2049         CDS       T01221                                 

Definition
family 5 glycosyl hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cse  Caulobacter segnis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cseg_2049
Enzymes [BR:cse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cseg_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2240066..2241418
Genome map
AA seq 450 aa AA seqDB search
MLAFTIALLLAPDAAAIADARGDWVGVVAAGDKSLRLSAHLERRGQGLIGVIDSPDQGAF
GLPLANIVQDGAKLSFDAPSVNARYEAHWDSARSAYVGRWIQNGQAIDLALTRGGYPHDF
DLDWNAPVDPGLAYQPAKRARPRVGPDLNVGKCVNMSNMLDAPTEGAWGPAFADDDFTII
KTAGFSSVRIPVAFSAHADTTPPYAIDPTFLARVRHVVTLASAAKLNVLLDMHHYDAMMR
DPDAEAPRFVALWRQVAQAFADAPPSVWFELLNEPNDKLTNDRLGALYAPALAAIRATNP
KRPVIVGPEWNNLDKMLAFEMPDDPYVAPSFHYYDPFLFTHQGAPWPNPAPPMGRSFGSA
ADRSELDRSVAKVRDYMARTGRVPILGEYGAQDDPRVPLAQRVRYYGVVSSAFASVGVAS
CAWGYRSGFRIREGDHWLPGIVEAIRAPKP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgcgttcactatcgccctgcttctcgccccggacgccgcggcgatcgccgatgcg
cgtggagactgggtcggcgttgtcgccgcgggcgacaaaagcttgaggctgtccgcgcat
ctggaacgtcgggggcaaggccttatcggcgtgatcgacagccccgaccaaggcgcgttc
ggccttcccctggccaacatcgtccaggacggcgctaagctcagtttcgacgcgcctagc
gtgaatgcgcggtacgaagcccattgggacagcgcgcgaagcgcctatgtcggtcgctgg
atccagaacggccaggccatcgacctcgcgctgacgcgcggaggctatccgcacgacttc
gatctcgactggaacgcgccggtcgatccgggcttggcttaccagccagccaagcgcgcc
aggccgcgcgttggtccggacctgaatgtcggcaagtgcgtcaacatgtccaacatgttg
gacgcgccaaccgagggggcctggggccccgccttcgccgacgacgattttacgatcatc
aagacagcgggcttctcgtccgtgcgcataccggtcgccttctccgctcacgccgacacg
acgccgccctatgcgatagatccaaccttcctggcccgcgtgcggcatgtcgtgacgctg
gccagcgccgccaagctgaacgtgctgctagacatgcatcactacgatgcgatgatgcgc
gaccccgacgccgaggctccacgttttgtcgcgctctggcgacaggtcgcccaagccttc
gcggacgcgccgcccagcgtctggttcgagctgctcaatgaaccgaacgacaagctgacc
aacgatcggcttggcgcgctctatgcgccggcgctggccgcgatccgggcgaccaatccc
aagcgccccgttatcgtcggccccgagtggaacaacctcgacaagatgctggcgttcgag
atgcccgacgatccctacgtcgcgcccagcttccactactacgatccgttcctgttcacg
caccagggcgcgccttggcccaatcccgcgccccccatgggccgaagcttcggctcggcg
gcggaccggagcgagctggaccgtagcgtcgccaaggtgcgcgactacatggcccgcacc
ggccgggttccgatcctgggcgaatacggcgcgcaggacgatccgcgcgtgccgttggcg
cagcgcgtccgatactacggtgtggtgagttcggcatttgcgtcggtcggggtcgccagc
tgcgcctggggttatcgctcgggctttcggatccgcgagggcgaccactggctgcccggt
atcgtggaagcgatccgtgcgcccaagccgtag

DBGET integrated database retrieval system