KEGG   Caulobacter segnis: Cseg_2109Help
Entry
Cseg_2109         CDS       T01221                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
cse  Caulobacter segnis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Cseg_2109
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cseg_2109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2316400..2316822)
Genome map
AA seq 140 aa AA seqDB search
MLAAIAAFWASEPPIPTEYPMKFQLTLAAVLAGFATSAVAAPPSGEQVFKQRCTVCHSVQ
PAPGKMGPPLAGVVGRKAGSAPGYAYSNAMKASGITWTPDQLDAFVKAPGKTVPGTKMLL
GAPNPEERAAVIQYLGTLKK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgctggccgcaatcgccgccttttgggcctctgaaccgccgatcccgacggagtatccg
atgaagttccagcttaccctcgccgctgtcctggcgggtttcgccaccagcgcggtcgcc
gcgccgccttccggcgaacaggtcttcaagcagcgctgcacggtctgccattcggtccag
cccgcgcccggcaagatggggccgccactggcgggcgtcgttggccgcaaggccggaagc
gcgccgggctacgcctacagcaacgccatgaaagcctcgggcatcacctggacgccggac
cagttggacgccttcgtcaaggctcccggcaagaccgtgcccggcaccaagatgctgttg
ggcgcgcccaatccagaagagcgcgcggcggtcattcaatatctggggacgctgaagaag
tga

DBGET integrated database retrieval system