KEGG   Caulobacter segnis: Cseg_2141Help
Entry
Cseg_2141         CDS       T01221                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
cse  Caulobacter segnis
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:cse00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    Cseg_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2348301..2349362
Genome map
AA seq 353 aa AA seqDB search
MSEVETALRGPEAYKVASRALELMERHQVWPTALNFELWTHYVADPDGPLARELTRLISI
GEPMTELVSEELAATYLPKVRLNDQIRDAGDILSKELEAVAKAIQNAQKSNAAFGKELAG
ATKNLDKSTDVEAIKVVVSNLADATRRVHRENQSLESRLAESTSEVERLREHLEQVRREA
TTDGLTNLANRKAFDEELDRACAEADRQGTPLCLAVLDIDHFKGFNDTWGHQTGDQVIRY
VASVIGRVAAPPRFAARYGGEEFAMIFPRENSAVIAASLEEIRVEVSSRMLKRRSTNEDL
GAITISSGFAERRPGESGHSIMERADAALYASKRNGRNRVTAAEGMPASANAA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagtcgaaaccgcgctgcgcggccctgaagcctataaggtcgcctcgcgcgcg
ctggagctgatggagcgccaccaagtgtggccgaccgcgctgaatttcgagctctggacg
cactatgtcgccgatcccgacggccccctcgcccgtgaactgacccggctgatctcgatc
ggcgagccgatgaccgagctggtcagcgaggagctggccgcgacctacctgcccaaggtg
cggctgaacgaccagatccgcgacgccggcgacatcctctccaaggaactggaggccgtc
gccaaggccatccagaacgcccagaaatccaacgccgccttcggcaaggaactggcgggc
gcgaccaagaacctcgacaagtccaccgacgtcgaggccatcaaggtcgtcgtctcgaac
ctggccgacgccacccgccgcgtgcatcgcgagaaccagtcgctggaatcccgtctggcg
gaatcgacctccgaggtcgaacgcctgcgcgaacacctcgaacaggtccgccgcgaagcc
accacggacggcctcaccaacctcgccaaccgcaaggccttcgacgaggaactggaccgc
gcctgcgccgaggccgaccgccagggcaccccgctgtgccttgccgtcctcgacatcgac
catttcaagggcttcaacgacacctggggccaccagaccggcgaccaggtcatccgttac
gtcgcctcggtgatcggtcgtgtcgccgccccgccgcgcttcgccgcccgctacggcggc
gaggaattcgccatgatcttcccgcgtgagaattcggcggtcatcgccgcctcgctcgag
gaaatccgcgtcgaggtgtcctcgcgcatgctcaagcgccgctcgaccaacgaggacctg
ggcgcgatcaccatctcgtcgggcttcgccgagcgtcgcccgggcgaaagcggccactcg
atcatggaacgcgccgacgcggccctctatgcgtccaagcgcaacggccgcaaccgcgtg
acggcggccgagggcatgcccgcctcggcgaacgcagcctag

DBGET integrated database retrieval system