KEGG   Caulobacter segnis: Cseg_2141Help
Entry
Cseg_2141         CDS       T01221                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
cse  Caulobacter segnis
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:cse00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    Cseg_2141
Enzymes [BR:cse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Cseg_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2348301..2349362
Genome map
AA seq 353 aa AA seqDB search
MSEVETALRGPEAYKVASRALELMERHQVWPTALNFELWTHYVADPDGPLARELTRLISI
GEPMTELVSEELAATYLPKVRLNDQIRDAGDILSKELEAVAKAIQNAQKSNAAFGKELAG
ATKNLDKSTDVEAIKVVVSNLADATRRVHRENQSLESRLAESTSEVERLREHLEQVRREA
TTDGLTNLANRKAFDEELDRACAEADRQGTPLCLAVLDIDHFKGFNDTWGHQTGDQVIRY
VASVIGRVAAPPRFAARYGGEEFAMIFPRENSAVIAASLEEIRVEVSSRMLKRRSTNEDL
GAITISSGFAERRPGESGHSIMERADAALYASKRNGRNRVTAAEGMPASANAA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagtcgaaaccgcgctgcgcggccctgaagcctataaggtcgcctcgcgcgcg
ctggagctgatggagcgccaccaagtgtggccgaccgcgctgaatttcgagctctggacg
cactatgtcgccgatcccgacggccccctcgcccgtgaactgacccggctgatctcgatc
ggcgagccgatgaccgagctggtcagcgaggagctggccgcgacctacctgcccaaggtg
cggctgaacgaccagatccgcgacgccggcgacatcctctccaaggaactggaggccgtc
gccaaggccatccagaacgcccagaaatccaacgccgccttcggcaaggaactggcgggc
gcgaccaagaacctcgacaagtccaccgacgtcgaggccatcaaggtcgtcgtctcgaac
ctggccgacgccacccgccgcgtgcatcgcgagaaccagtcgctggaatcccgtctggcg
gaatcgacctccgaggtcgaacgcctgcgcgaacacctcgaacaggtccgccgcgaagcc
accacggacggcctcaccaacctcgccaaccgcaaggccttcgacgaggaactggaccgc
gcctgcgccgaggccgaccgccagggcaccccgctgtgccttgccgtcctcgacatcgac
catttcaagggcttcaacgacacctggggccaccagaccggcgaccaggtcatccgttac
gtcgcctcggtgatcggtcgtgtcgccgccccgccgcgcttcgccgcccgctacggcggc
gaggaattcgccatgatcttcccgcgtgagaattcggcggtcatcgccgcctcgctcgag
gaaatccgcgtcgaggtgtcctcgcgcatgctcaagcgccgctcgaccaacgaggacctg
ggcgcgatcaccatctcgtcgggcttcgccgagcgtcgcccgggcgaaagcggccactcg
atcatggaacgcgccgacgcggccctctatgcgtccaagcgcaacggccgcaaccgcgtg
acggcggccgagggcatgcccgcctcggcgaacgcagcctag

DBGET integrated database retrieval system