KEGG   Caulobacter segnis: Cseg_2181Help
Entry
Cseg_2181         CDS       T01221                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cse  Caulobacter segnis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cseg_2181
   01230 Biosynthesis of amino acids
    Cseg_2181
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cseg_2181
   00051 Fructose and mannose metabolism
    Cseg_2181
   00562 Inositol phosphate metabolism
    Cseg_2181
Enzymes [BR:cse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cseg_2181
Exosome [BR:cse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cseg_2181
  Exosomal proteins of bladder cancer cells
   Cseg_2181
  Exosomal proteins of melanoma cells
   Cseg_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2389345..2390106)
Genome map
AA seq 253 aa AA seqDB search
MTLSSTTPRPLIAGNWKMNGLAAALDEARAVAAALEQRPASARVAIFPPSTLLHRLAEAV
EGSTVLVGGQDCHPKASGAHTGDISAEMIGDAGGAMVIVGHSERRTDHGETCQQVAAKVE
AALAGDLEPVICVGESLEQRQAGEAVSFVVGQLRNSLPDSLQGKAFNVAYEPIWAIGTGH
VASVDNIIEMHAAIRAELATRFGEQGRTIPILYGGSVKPENAAEILAAPEVGGALVGGAS
LKAKDFLAIIQAA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttcaagcacgacgccccggccgttgatcgccggaaactggaaaatgaacggc
ctggcggccgctctggatgaagcccgcgccgtcgcggcggcgctggagcaacgtccggcc
tcggcgcgggtggcgatcttcccgccttcgaccctgctgcaccggctggcggaggctgtg
gagggctccaccgtcttggtcggcggccaggactgccatccgaaggccagcggcgcccat
acgggcgacatctcggccgaaatgatcggcgacgcgggcggcgccatggtcatcgtcggc
cattctgagcggcggaccgatcacggagagacctgccagcaggtggccgccaaggtcgaa
gcggctctagccggggatctggaaccggtcatctgcgtcggcgagagcctggaacagcgt
caggccggcgaggcggtgagcttcgtggtcggtcagctgcgcaactcgctaccggacagc
ctccaaggcaaggccttcaatgtcgcctacgagccgatctgggcaatcggcactggccat
gtcgcctccgtcgacaatatcatcgagatgcacgcggccatccgcgccgagctggcgacc
cgtttcggcgagcagggccggacgatcccgatcctctatggcggctcggtcaagcccgag
aacgcggccgagattctggccgcgccggaagtcggcggcgccctggtcggcggcgcctcg
ctgaaggccaaggatttcctggccatcatccaggccgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system