KEGG   Caulobacter segnis: Cseg_2187Help
Entry
Cseg_2187         CDS       T01221                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cse  Caulobacter segnis
Pathway
cse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cse01100  Metabolic pathways
cse01110  Biosynthesis of secondary metabolites
cse01130  Biosynthesis of antibiotics
cse01230  Biosynthesis of amino acids
Module
cse_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cseg_2187
Enzymes [BR:cse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cseg_2187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS CP_ATPgrasp_2 Lactamase_B_5
Motif
Other DBs
NCBI-ProteinID: ADG10650
UniProt: D5VJX1
Position
2395712..2396500
Genome map
AA seq 262 aa AA seqDB search
MTDILAKIAAYKREDVAARKAVRSQADVDAAAKAASPTRGFKAALETRHAPGKLSLIAEI
KKASPSKGLIREDFDPPVLAKAYEAGGAACLSVLTDGPSFQGADEYLVAARAATTLPCIR
KDFLVDPWQVAESRALGADAILVILAMIDDVLAAELMSEAKRLGMDALVEVHDEAEMARA
GALGSDLVGINNRDLKSFVVDLAVTERLSAQAPKGALLVTESGVFTHDDAVRMEAAGAKA
MLVGESLMRHADVTAATKTLIG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacatcctggccaagatcgccgcctacaagcgcgaggacgtcgccgcccgcaag
gccgtccgctcgcaagccgatgtcgacgccgccgccaaggccgcctcgccgacgcgtggc
ttcaaggcggccctggagaccaggcacgcgcccggcaagctgtcactgatcgccgagatc
aagaaggcctcgccgtccaagggcctgatccgtgaggatttcgatccgccggtcctggcc
aaggcctacgaggccggcggcgcggcctgcctgtcggtcctgacggatggtcccagcttc
cagggggcggacgaatatctggtggccgcccgcgcggcgaccaccctgccctgcatccgc
aaggacttcctggtcgatccttggcaagtggctgaaagccgcgccctcggcgccgacgcg
atcctggtgatcctggccatgatcgacgacgtcctggcggccgagctgatgtccgaggcc
aagcgcctgggcatggacgccctggtcgaggtgcacgacgaggccgagatggcccgcgcc
ggcgcgctgggctcggatctggtcgggatcaacaaccgcgacctgaagagcttcgtcgtc
gacctcgccgtcaccgaacggctgtcggcgcaggccccgaagggcgccctcctggtcacc
gagagcggcgtcttcacccacgacgacgcggtgcggatggaggcggccggcgccaaggcc
atgctggtcggcgagagcctgatgcggcacgccgacgttacggccgccaccaagacacta
atcggctga

DBGET integrated database retrieval system