KEGG   Caulobacter segnis: Cseg_2675Help
Entry
Cseg_2675         CDS       T01221                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
cse  Caulobacter segnis
Pathway
cse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cse00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cseg_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ADG11124
UniProt: D5VKV1
Position
2924837..2925343
Genome map
AA seq 168 aa AA seqDB search
MRTLKLTAFAALAVALVACSKDGGSSSEAPADAPASAPAAAAPTDVEKAAALAALPAPYN
TGDLANGQSKFALCRSCHTITEGGPDLTGPNLYGVFGRKAGAKAGYSYSDVVKAAGFTWD
AEHLDKWLADPRGFMPGTKMTFAGLKNPKDRIDLIAYLKVETGYKPAP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgctgaaactgaccgccttcgccgcgctcgccgtcgccctcgtcgcctgctcg
aaggatggcgggagctcctcggaggcgccggcggatgcgccggcctcggcgcccgcggcc
gccgcccccaccgacgtcgaaaaggccgcggccctggccgccctgcccgccccgtacaac
accggcgacctcgccaacggccagagcaagttcgcgctttgccgctcgtgccatacgatc
accgaaggcggtccggacctgaccggccccaacctctatggcgtcttcggccgaaaggcg
ggcgccaaggcgggctacagctattccgacgtcgtgaaggcggccggcttcacctgggac
gccgagcacctggacaagtggctggccgatccgcgcggcttcatgccgggcaccaagatg
accttcgccggcctcaagaacccgaaggatcggatcgacctgatcgcctatctgaaggtc
gaaacgggctacaaaccggcgccatag

DBGET integrated database retrieval system