KEGG   Caulobacter segnis: Cseg_2675Help
Entry
Cseg_2675         CDS       T01221                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
cse  Caulobacter segnis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Cseg_2675
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cseg_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2924837..2925343
Genome map
AA seq 168 aa AA seqDB search
MRTLKLTAFAALAVALVACSKDGGSSSEAPADAPASAPAAAAPTDVEKAAALAALPAPYN
TGDLANGQSKFALCRSCHTITEGGPDLTGPNLYGVFGRKAGAKAGYSYSDVVKAAGFTWD
AEHLDKWLADPRGFMPGTKMTFAGLKNPKDRIDLIAYLKVETGYKPAP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgctgaaactgaccgccttcgccgcgctcgccgtcgccctcgtcgcctgctcg
aaggatggcgggagctcctcggaggcgccggcggatgcgccggcctcggcgcccgcggcc
gccgcccccaccgacgtcgaaaaggccgcggccctggccgccctgcccgccccgtacaac
accggcgacctcgccaacggccagagcaagttcgcgctttgccgctcgtgccatacgatc
accgaaggcggtccggacctgaccggccccaacctctatggcgtcttcggccgaaaggcg
ggcgccaaggcgggctacagctattccgacgtcgtgaaggcggccggcttcacctgggac
gccgagcacctggacaagtggctggccgatccgcgcggcttcatgccgggcaccaagatg
accttcgccggcctcaagaacccgaaggatcggatcgacctgatcgcctatctgaaggtc
gaaacgggctacaaaccggcgccatag

DBGET integrated database retrieval system