KEGG   Caulobacter segnis: Cseg_2774Help
Entry
Cseg_2774         CDS       T01221                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cse  Caulobacter segnis
Pathway
cse00240  Pyrimidine metabolism
cse00250  Alanine, aspartate and glutamate metabolism
cse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cseg_2774
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cseg_2774
Enzymes [BR:cse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Cseg_2774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADG11222
UniProt: D5VL49
Position
3036253..3037248
Genome map
AA seq 331 aa AA seqDB search
MTASAHDPSQAAIETIRARVFAFPKRHFLSAGDLNALQAVELLDLADAFVALNRQTSKTL
DILKGRTLMNLFFENSTRTQSSFELAGKRLGADVVNMNPKTSSVAKGETLIDTAVTLNAM
RPDLLVIRHASSGAASLLSQKVSGHVVNAGDGQHEHPTQAVLDALSIRRAFGRVSGLTVA
ICGDVLHSRVARSNVALLHTLGASVRLVGPPTLMPSQAERWGVTVHHDMKSGLAGADVVM
MLRLQLERMQGAFVPSTREYFRFYGLDREKLSRAAPGAKVMHPGPMNRGVEIDSDVADDP
AISLIQDQVEMGVAARMAVLTSLAARLEAAQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacggcttcagcccatgacccctcccaagcggctatcgaaacgatccgcgcgcgcgtc
ttcgcctttcccaagcgccactttctttcggccggcgatctgaacgcgcttcaggcggtc
gagctgctggacctggccgacgccttcgtggctctgaaccggcagacgtccaagaccctc
gatatcctcaagggccggacgctgatgaacctgttcttcgagaacagcacccgcacccag
agctcgttcgagctggcgggcaagcggctgggcgccgacgtcgtcaacatgaaccccaag
acctcgtcggtggccaagggcgagaccctgatcgacaccgcggtcacgctgaacgccatg
cggcccgacctgctggtcatccgccacgcctcgtcgggcgcggccagcttgctgtcgcag
aaggtcagcggccacgtggtcaacgccggcgacgggcagcacgagcacccgacccaggcc
gtgctggacgcgctgtcgatccgccgcgccttcggccgcgtttccggcctgaccgtggcg
atctgcggcgacgtgctgcacagccgcgtcgcgcgctcgaacgtcgccttgctgcacacc
ctgggcgccagcgtgcgcctggtggggccgcccaccctgatgccgtcccaggccgagcgc
tggggcgtcacggtgcaccacgacatgaaatcgggcctggccggcgccgacgtcgtcatg
atgctgcgcctgcagctggaacggatgcaaggcgccttcgtgccctcgacccgcgagtac
ttccgcttctatggcctggatcgcgaaaagctttcgcgcgcggcgcccggcgccaaggtc
atgcaccctgggcccatgaaccggggcgtggagatcgatagcgacgtcgccgacgatccg
gccatcagcctgatccaggaccaggtcgagatgggcgtcgccgcccggatggccgttctc
accagcctcgcggcccgtctggaggcggcccaatga

DBGET integrated database retrieval system