KEGG   Caulobacter segnis: Cseg_2824Help
Entry
Cseg_2824         CDS       T01221                                 

Definition
glycosyl hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cse  Caulobacter segnis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3087671..3088912)
Genome map
AA seq 413 aa AA seqDB search
MKPRHQVSRAAVDLIKRFEGYRQTSAQLPDGRWTIGYGHTLTARPGATVSEKDAEALLLY
DLISVAHSVNEHTYTPLTQNQFDALVCFAFNIGIENFVRSGVLRRINEGSLLQAACAMEM
WRKADFEGERIVIDALVRRRSAEKTLFLTPANGEWVPAPSPVLRPKIDYDASNAIPKQTP
ATVSTRTDGDRVVAHREGDLPFSIVVPEEDRPTATEQSAAAVSARLEAILAEAETPPSKA
QPDLGLPEPPAPQTGKAAGAAPGPVLFPDMPVELTPFRPSPQAPDKPATVEAFAPGPVAN
EPTLFSPSADGGSAFNLDGFSTSAATELSPAAEIAGGRRKAARSSNASLLIVLGLLGLAL
FGGGVLWILTVAAGAGDQVRLFGYGASMIGAICFVVSAYLLLRRLAGPDRAGE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcgtcatcaggtctcccgcgccgccgtcgatctcatcaagagattcgagggc
taccgtcagacgtccgcccagcttcccgatggacgctggacgatcggctatggccacacg
ctgaccgcgcgcccgggcgcgactgtctcggaaaaggacgccgaggcgctgctgctctat
gacctgatctcggtggcccattcggtcaacgaacacacctacacgccgctgacccagaac
caattcgacgccctggtctgcttcgccttcaacatcgggatcgagaacttcgtgcgctcg
ggcgtgctgcgccggatcaacgaaggttcgctgctgcaggccgcctgcgccatggagatg
tggcgcaaggccgacttcgagggcgaacgcatcgtcatcgacgccctggttcgtcgccgt
tcggctgaaaagaccctgttcctgacgccggcgaacggcgagtgggtgcccgcgcccagt
cccgtgttgcggccgaagatcgactacgacgccagcaacgcgatcccgaagcagacgccg
gcgacggtcagcacccgcaccgacggcgaccgcgtcgtcgcccaccgcgaaggcgacctg
ccgttcagcatcgttgtcccggaagaggacaggccgaccgcgaccgagcagtcggccgcc
gccgtcagcgcgcggctcgaggccatcctcgccgaggcggaaacgccgcccagcaaggcg
cagccggaccttggcctgccagagccgcccgcgccccaaaccgggaaggccgccggcgcc
gcgccggggcccgtcctgttcccggacatgccggtcgagctgacgcccttccgcccgtcg
cctcaggctcctgacaagccggcgaccgtggaggctttcgcgccgggtcccgtcgccaat
gagccgacgctgttcagcccgtcggcggacggtgggtcggccttcaatctcgacggcttc
tcgaccagcgccgcaaccgagctttcgcccgcggccgaaatcgccggcggtcgtcggaag
gcggcgcgttcgagcaatgcgagcctgctgatcgtcctcggactgctgggccttgcgctg
ttcggcggcggcgtcctgtggatcctgaccgtcgcggccggggccggtgatcaggtcagg
ctgttcggctatggcgcgagcatgatcggcgccatctgcttcgtggtttcggcgtatctt
ctgttgcgccgactggcggggccggacagggcgggcgaataa

DBGET integrated database retrieval system