KEGG   Caulobacter segnis: Cseg_2915Help
Entry
Cseg_2915         CDS       T01221                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cse  Caulobacter segnis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cseg_2915
   00030 Pentose phosphate pathway
    Cseg_2915
   00051 Fructose and mannose metabolism
    Cseg_2915
   00052 Galactose metabolism
    Cseg_2915
   00500 Starch and sucrose metabolism
    Cseg_2915
   00520 Amino sugar and nucleotide sugar metabolism
    Cseg_2915
  Nucleotide metabolism
   00230 Purine metabolism
    Cseg_2915
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cseg_2915
Enzymes [BR:cse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Cseg_2915
    5.4.2.8  phosphomannomutase
     Cseg_2915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3168059..3169555
Genome map
AA seq 498 aa AA seqDB search
MFSAPRADLVPNTAAYENEPLVKATGFREYDARWLFGPEINLLGVQALGLGLGTYIHELG
QSKIVVGHDFRSYSSSIKNALILGLISAGCEVHDIGLALSPTAYFAQFDLDIPCVAMVTA
SHNENGWTGVKMGAQKPLTFGPDEMSRLKAIVLGAEFVERDGGKLIRVQGEAQRYIDDVA
KRASITRPLKVIAACGNGTAGAFVVEALQKMGVAEVVPMDTDLDFTFPKYNPNPEDAEML
HAMAHAVHEHKADLAFGFDGDGDRCGVVDDEGEEIFADKIGLMLARDLAPLHPGATFVVD
VKSTGLYATDEILKAHGCQVIYWKTGHSYIKRKSAELGALAGFEKSGHFFMNGELGYGYD
CGLTAAAAVLAMLDRNPGKKLSDLKKALPVAFTSLTMSPHCGDEVKYGVVADVVKEYEDL
FAAGGSILGRKITEVITVNGVRVHLEDGSWVLVRASSNKPEVVVVVESTQSEDDMRALFR
QEVKPRLGDRVGKYNQEI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgttctccgcgccgcgcgccgatctcgttcccaataccgccgcctatgaaaacgagccg
ctggtcaaggcgacgggctttcgcgagtacgatgcgcgttggctgttcgggcccgagatc
aacctgctgggcgttcaggccctcggtctgggtctggggacctacatccacgagttgggt
cagtcgaagatcgtcgtcggccacgacttccgctcgtactcgtcgtcgatcaagaacgcc
ctgatcctgggcctgatcagcgccggctgtgaggtgcacgacatcggcctggcgctctcg
ccgacggcctatttcgctcagttcgacctggacatcccgtgcgtggccatggtcacggcc
agccacaacgagaacggctggaccggcgtgaagatgggcgcccagaagccgctgaccttc
ggcccggacgagatgagccgcctgaaggcgatcgtgctgggcgctgagttcgtcgagcgc
gacggcggcaagctgatccgcgtccagggcgaggcccaacgctacatcgacgacgtcgcc
aagcgcgccagcatcacccgtccgctgaaggtcatcgccgcctgcggcaacggcacggcc
ggcgccttcgtggtcgaggccctgcagaagatgggcgtggccgaggtcgtgccgatggac
accgacctcgacttcaccttccccaagtacaaccccaatcccgaagacgccgagatgctg
cacgcgatggcccacgccgtccacgagcacaaggcggacctggcgttcggcttcgacggc
gacggcgaccgctgcggcgtcgtggatgacgagggcgaggagatcttcgccgacaagatc
ggcctgatgctggcccgggatctggcccctctgcatcccggcgcgaccttcgtggtcgac
gtcaagtcgaccggcctctacgccaccgacgagatcctgaaggcccacggctgccaggtg
atctactggaagaccggccacagctacatcaagcgcaagagcgccgagctgggggccctg
gccggcttcgagaagagcggccacttcttcatgaacggcgagctgggctacggctacgac
tgcggcctgaccgccgccgccgccgtcctggccatgctggaccgcaatccgggcaagaag
ctcagcgacctgaagaaggccctgccggtggccttcacctcgctgaccatgagcccgcac
tgcggcgacgaggtgaagtacggcgtcgtcgccgacgtcgtgaaggaatacgaggacctg
ttcgccgccggcggctcgatcctgggccgcaagatcaccgaggtgatcacggtcaacggc
gtgcgcgtccacctggaggacggctcgtgggtcctggtccgcgcctcgtcgaacaagccc
gaggtcgtggtggtggtcgagagcacccagtccgaggacgacatgcgcgccctcttccgc
caggaggtcaagccgcgcctgggcgaccgggtcggcaagtacaatcaggagatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system