KEGG   Caulobacter segnis: Cseg_3068Help
Entry
Cseg_3068         CDS       T01221                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cse  Caulobacter segnis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3343435..3344373)
Genome map
AA seq 312 aa AA seqDB search
MAVVAILARRPVIHASVEATRPAATPPKGAFNALTVRHIPPSAQEAREIALGELLFGDTR
LSGDGKRSCVTCHDVTTNGASGRERDLTPQGQPLPVNTPTVFNAARNFRLNWSGNARTLE
SQARASLQNPSIMGADLTKVARVLAADAATAERFHDTYRRDPRPEDIVRALARYEATLIT
PGSRFDHYLMGEALALSAGEQRGYKLFQSVGCASCHQGVNVGGNLYQRSGVFHPAAKADS
PVLRVPSLRNVATTAPYFHDGSAETLEDAVRAMGRAQLNRVLTADQVADIAAFLRSLNGV
YRDRPVTQAAPR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggtcgccatcctggcgcggaggcccgtgatccatgccagcgtcgaggccact
cgcccagcggccacgccccccaagggcgccttcaacgccttaactgtccgccacattcca
ccttcggcgcaagaagcgcgcgagatcgccctgggcgagctgctgtttggcgacaccaga
ttgtccggcgacggcaagcgcagctgcgtgacctgtcatgacgtcacgaccaatggcgcg
agcgggcgcgaacgggacctcacaccgcaaggccaaccgctcccggtgaacaccccgacc
gtgttcaatgcggcgaggaacttccgtcttaactggtccggcaacgcccgaaccctggag
agccaagcgcgcgcctctcttcaaaatccatcgatcatgggcgccgacctcaccaaggtc
gcgcgggttctggcggcggacgcggcgacggccgaacggttccacgacacctaccggcgc
gaccctaggcccgaggacatcgtgcgggcgctcgcgcggtacgaggccacgctcatcact
ccgggatcgcgatttgatcactatctgatgggagaggccctggccctgtcggccggcgag
cagcgaggatataagctttttcagtcggtgggctgcgcctcgtgccaccaaggggtgaac
gtaggcggcaatctctatcagcgcagcggcgtcttccatcccgccgccaaggccgactcg
ccggtgctgcgcgtgccatcgctccgcaacgtcgccaccaccgcgccctattttcacgat
ggcagcgccgagacgctcgaggacgccgtgcgcgccatggggcgcgctcagctgaaccgc
gtcctgaccgccgaccaggtcgccgacatcgccgccttcctccgaagcttgaacggcgtc
tatcgtgatcggcccgtgacgcaggccgcgccaagatga

DBGET integrated database retrieval system