KEGG   Caulobacter segnis: Cseg_3275Help
Entry
Cseg_3275         CDS       T01221                                 

Definition
glycosyl hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cse  Caulobacter segnis
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cse00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cse00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3581078..3583570)
Genome map
AA seq 830 aa AA seqDB search
MAQINRRQALAAAGGAALLANASRAAAAVASPVPAVDLGPRERSSLDFGWRFALGHASDP
AKDFGFGANQRTYAKAGASAPNWWVAAAAQADFDDSAWKPVTLPHDWAVELPFANNLDYK
PSGKPDDEDLRAAHGYKALGREFPENSVGWYRKSFALPAGDAGKRLSIEFDGAFRDALVM
VNGYILEREDSGYSPFRVDITDIANIGGDNLVTVRVDASLGEGWFYEGAGLYRHVWLVKT
APVHVPQWGVFVRAKVDGTVQIDTDLINESDAAQAFEVSHAVLDAAGKPVLAVAPAAGRL
PAWERQSLSQTVTLADPVLWSLENPHLYTLVTETKVGGAVVDRFVTRFGVRSIRFDGQRG
FFLNDKPVKLKGSCNHQDHAGVGAAIPDALQVWRLEQLKSMGSNAYRAAHNPPTPELLEA
CDRLGILVIDETRRMSSDPTSMDELERLVRRDRNHPSVILWSIGNEEPQQATARGVKVAT
TMKRLVNRLDPTRLVTAAMDNGFGEGISAVIDVQGFNYRHEKMDDFHARFPNVPIIGSES
ASVVTTRGEYVRDEAKSYVPAYDTDHPWWATTAEKWWSHAADRPWMAGGFIWTGFDYRGE
PTPFNRWPSISSHFGAFDTCGFPKDNYYYYRAWWRSEPLLHLLPHWNWEGREGQPIAVWA
HSNCDKVELFLNGKSQGVRDVKANHHVEWSVPYAPGVLEAHGYKNGKVILRERRETAGPA
AALRLTADRVRLAADGQDVAVLKVEVLDAKGRPVPRAEDLVRFELSGPIDLIGVGNGNPT
SHEADVALQRKAFNGLAQGIVRTRQNQSGRGRVVVSAPGLKSAALDLTAG
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatcaaccgacgccaggctctggccgccgccgggggcgccgcccttctggcc
aatgcttcgcgcgccgccgcggcggtcgcatcgcccgtgcccgctgtcgaccttggcccg
cgggagcgttcgtcgctcgatttcggctggcgcttcgcgttggggcacgcctctgacccg
gccaaggatttcggcttcggcgccaaccagcgcacctacgccaaggccggcgccagcgcg
cccaactggtgggtggcggccgccgcgcaggccgacttcgacgacagcgcctggaagccg
gtgacgctgccgcacgactgggccgtcgagctgccgttcgccaacaacctcgactacaag
ccctcgggcaagccggacgacgaggacctgcgcgccgcccacggctacaaggcgctgggc
cgcgagttccccgagaacagcgtcggctggtaccgcaagagcttcgccctgccggcaggc
gacgccggcaagcgcctgtcgatcgagttcgacggcgccttccgcgacgccctggtgatg
gtcaacggctacatcctcgagcgcgaggacagcggttactcgccgttccgcgtcgacatc
accgacatcgccaacatcggcggcgacaacctggtcacggtccgcgtcgacgccagcctg
ggcgagggctggttctatgaaggggcggggctctaccgccacgtctggctggtcaagacc
gcgccggtgcacgtgccgcagtggggcgtcttcgtccgcgccaaggtcgacggcacggtc
cagatcgacaccgacctgatcaacgagtccgacgcggcccaggccttcgaggtttcgcac
gcggtgttggacgccgccggcaagcccgtcctggccgtcgcccccgccgccggccgcctg
ccggcctgggagcgccagagcctgtcccagaccgtcaccctggccgatccggtgctgtgg
agcctcgagaacccgcacctctataccctggtcaccgagaccaaggtcggcggcgccgtc
gtggaccgcttcgtcacgcgcttcggggtccgctcgatccgcttcgacggccagcggggc
ttcttcctgaacgacaagccggtgaagctgaagggcagctgcaaccaccaggatcacgcc
ggcgtcggcgcggcgatcccggacgccctgcaggtctggcgcctggaacagctgaagtcg
atgggcagcaacgcctatcgcgccgcccacaatccgccgacgccggagctgctggaggcc
tgcgaccgcctggggatcctcgtgatcgacgagacccgccggatgtccagcgatccgacc
tcgatggacgagctggagcggctggtgcgccgagaccgcaaccacccttcggtgatcctg
tggtcgatcggcaacgaggagccgcagcaggccaccgcgcgcggcgtcaaggtcgccacg
acgatgaagcgcctggtcaatcggctcgacccgacccgcctggtcaccgccgccatggac
aacggcttcggcgagggcatcagcgccgtcatcgacgtgcagggcttcaattaccgtcac
gagaagatggacgacttccacgcccgcttcccgaacgtgccgatcatcggcagcgagagc
gccagcgtggtgacgacgcggggcgagtatgtccgagacgaggccaagtcctatgtcccg
gcctacgacaccgaccacccctggtgggcgacgaccgccgagaagtggtggagccacgcg
gccgaccggccgtggatggcgggcggcttcatctggaccggcttcgactatcgcggcgag
ccgacgccgttcaaccgctggcccagcatcagctcgcacttcggggcgttcgacacctgc
ggcttcccgaaggacaactactattactaccgcgcctggtggcggtccgagccgctgctg
cacctgctgccgcactggaactgggaaggccgcgagggtcagccgatcgcggtctgggcg
cacagcaactgcgacaaggtcgagctgttcctcaacggcaagagccagggcgtccgcgat
gtgaaggccaaccatcacgtcgagtggtccgtgccttacgcgccgggcgtgctggaggct
catggctacaagaacggcaaggtgatcctgcgcgagcgccgcgagaccgccggccccgcc
gccgctctgcgcctgacggccgaccgcgtccgcctcgccgccgacggccaggacgtggcg
gtgctgaaggtcgaggtgctggacgccaagggccgccctgttccgcgcgccgaagacctg
gtccgcttcgagctttcgggcccgatcgacctgattggcgtcggtaatggaaacccaacg
agccacgaagcggacgtcgcgcttcagcgcaaggcgttcaacggcctggcccagggtatc
gtccgcacccggcagaatcagtcggggcggggcagggtggtcgtcagcgcgcctggcctg
aagagtgctgccctcgacctgacggccggctga

DBGET integrated database retrieval system