KEGG   Caulobacter segnis: Cseg_3428Help
Entry
Cseg_3428         CDS       T01221                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
cse  Caulobacter segnis
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cse00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cse02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3756183..3756884
Genome map
AA seq 233 aa AA seqDB search
MSDLTFNKIAGGVLLTGLVIFGLREASDIVFKKTEVEKAGYEIAVQEESAEGGAAAADTP
PDWNAVLTPANVAAGQAVSAKCAACHKLDASNANSTGPGLWDVVGRKPAGHPGFNYSGAM
KDFAGKQPIWDYDALYTFLKAPGKDVPGTNMTFVGLKKPEDRIALIAYLHSLGSTLPVPP
PRPAAAAAPAAEGAPAADAAAPGAPGGTTAPAAGAAAAPAAPAAGGNTAPPKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctgacgttcaacaagatcgctggcggcgtgctgctgaccggcctcgttatt
tttggtctccgggaagcttcggacatcgtcttcaagaagaccgaggtcgagaaggccggc
tacgagatcgccgtccaggaagaaagcgccgaaggcggcgcggccgccgcggacacgccg
ccggattggaacgccgtgctgacgccggccaacgtggccgccggccaggccgtttcggcc
aagtgcgccgcctgccacaagctggacgcgtcgaacgccaactccaccggccctggtctg
tgggacgtggtgggccgcaagccggccgggcacccgggcttcaactattcgggcgcgatg
aaggacttcgcgggcaagcagcccatctgggactacgacgcgctgtacaccttcctgaag
gcgcccggtaaggacgtccccggcaccaacatgaccttcgtgggtctgaagaagccggaa
gaccgcatcgcgctgatcgcctacctgcacagcctgggctcgacgctgccggttccgccg
ccgcgtcccgccgccgccgcggctccggccgccgagggcgcgcccgccgctgacgccgcc
gcgcctggcgctccgggcggtacgaccgctccggccgccggcgccgccgcggcccccgcc
gctccggcggctggcggcaatacggctccgccgaaggcctga

DBGET integrated database retrieval system