KEGG   Caulobacter segnis: Cseg_3464Help
Entry
Cseg_3464         CDS       T01221                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cse  Caulobacter segnis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cseg_3464
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cseg_3464
  Lipid metabolism
   00071 Fatty acid degradation
    Cseg_3464
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cseg_3464
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cseg_3464
   00626 Naphthalene degradation
    Cseg_3464
Enzymes [BR:cse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cseg_3464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3788225..3789259
Genome map
AA seq 344 aa AA seqDB search
MDTMMKAAVVRAFGQPLVIEDRPRPKPGRGQVLVKIAACGVCHTDLHAAHGDWPIKPSLP
FVPGHEGVGAVVELGEDVEHLKIGDRVGVPWLHTACGRCVHCLAGWETLCEKQQNTGYSV
DGGFAEYVLADADYVGLIPANLTFVEAAPILCAGVTVYKGLKVLDAKPGDWVAISGVGGL
GHLAVQYAKAMGFKVAAVDVAEDKLALARALGAELTVDASREDPVAVFQAKVGGVQGVLV
TAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLSIFDTVLRGITVRGSIVGTRLDLQEAL
AFAADGRVKATVSTEGLDAINDIFQRMEKGAIEGRVVLDFEAAR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggatacgatgatgaaggccgccgtggtgcgggcctttggccagccgctggtgatcgag
gatcggccgcgccccaagcccggacgtggccaggtgctggtcaagatcgccgcctgtggc
gtctgccacaccgatctccacgccgcccacggcgactggccgatcaagccgtccctgccc
ttcgtgcccggacatgaaggcgtcggcgcggtcgtcgaactgggcgaagacgtcgagcac
ctgaagatcggcgaccgcgtcggcgtgccctggctgcacaccgcctgcggccgctgcgtc
cactgcctggccggctgggagaccctctgcgagaagcagcagaacaccggctattcggtc
gacggcggcttcgccgaatacgtcctggccgacgccgactatgtcgggctgatcccggcc
aacctcactttcgtcgaggccgcgccgatcctgtgcgccggggtcaccgtctataagggc
ctcaaggtgctggacgccaagccgggcgactgggtggcgatctcgggcgtcgggggcctg
gggcacctggcggtgcaatacgccaaggccatgggcttcaaggtcgccgccgtcgacgtg
gccgaagacaagctggccctggcgcgcgctctgggcgccgagctcacggtggacgccagc
cgcgaggatccggtcgccgtgttccaggccaaggtcgggggcgtgcaaggcgtgctggtc
acggccgtctcgcgcggcgccttcgcccaggcgctgggcatggtccggcgcggcggaacc
gtgtcgctgaacggcctgccgcccggcgacttcccgctgtcgatcttcgacaccgtgctg
cgcggcatcaccgtgcgcggctcgatcgtcggcacgcgcctggacctgcaggaggccctg
gccttcgccgccgacggccgggtcaaggcgacggtctcgaccgagggcctggacgccatc
aacgacatcttccaacgcatggagaaaggcgcgatcgaaggccgggtggtgctggacttt
gaggccgcgcggtga

DBGET integrated database retrieval system