KEGG   Caulobacter segnis: Cseg_3476Help
Entry
Cseg_3476         CDS       T01221                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
cse  Caulobacter segnis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3800138..3801181)
Genome map
AA seq 347 aa AA seqDB search
MLLVVAALGFQAVTMSACAAPTPGNWADYKTRFLQADGRVVDTGNGNVSHSEGQGFAMIM
ATAYDDPATFKKMWTWTDKTLSRPDTRLFKWRYIPTGDLHTPDPNNALDGDMLIAWALLR
GGERWKRPEYLEASAQIRSAILSKLLVKQGNRTLLVPGVDGFVNAQGMIFNPSYAIMPAL
DAFAAREPKSPWPMVRDETLRALRDARFGATDLPVDWVKVDTAGAMWTDPDRPPRFGFDA
IRVPLYMCWSGRCGDASLDPVKRWWTSFRAAGKPAPAWIDVRTGEVAPFAAPVGMVSVAD
LALTGKASSARIQNEDYYSSSLLILSQIAADERREKTKSAAKPKPKS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggtggtcgcggccctgggcttccaggcggtgaccatgagcgcctgcgccgcg
cctacgcccggcaactgggcggactacaagacccggttcctccaggccgacgggcgggtg
gtcgacaccggcaacggcaatgtcagccactccgaaggccagggcttcgcgatgatcatg
gccacggcctatgatgatccggcgaccttcaagaagatgtggacctggaccgacaagacc
ctgtcgcggccggacacgcgcctgttcaagtggcgctacatccccacgggggatctgcac
acccccgatccgaacaacgccctggacggcgacatgctgatcgcctgggccctgctgcgc
ggcggcgagcgctggaagcgccccgaatatctcgaggccagcgctcagatccgcagcgcg
atcctgagcaagctgctggtcaagcaggggaaccggactctgctggtcccgggcgtcgac
ggcttcgtcaacgcccaggggatgattttcaacccgtcctacgcgatcatgccggcgctt
gacgccttcgccgcgcgcgagccgaagtcgccctggccgatggtccgggacgagacgctc
agggcccttcgcgacgcccgcttcggcgccacggacctgcccgtcgactgggtgaaggtc
gacacggccggcgccatgtggaccgaccccgaccgcccgccgcgcttcggtttcgacgcc
atacgggtgccgctctacatgtgctggtcgggccgctgcggcgacgcctcgctggatccg
gtcaagcgctggtggacttcgttccgcgcggcgggcaagccggccccggcctggatcgac
gtgcgcaccggcgaagtcgccccgttcgccgcgccggtcggcatggtcagcgtcgcggac
ctggccctgaccggcaaggcctcgtccgcccggatccagaacgaggactactattcctcg
tccctgctgatcctcagccagatcgccgccgacgaacggcgcgagaagaccaagtcggcg
gccaagcccaagcccaagtcctga

DBGET integrated database retrieval system