KEGG   Caulobacter segnis: Cseg_3739Help
Entry
Cseg_3739         CDS       T01221                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cse  Caulobacter segnis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cse00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cse00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4098629..4100902)
Genome map
AA seq 757 aa AA seqDB search
MTLTPLRTVVVSALALAAAFATPAGAADLTLTPAPAKAVRAEGAFKLSAATRIHVAKGDV
EARGVANQLADLIRRSRGFRPAVVEGGPTAGAIVLTREGPSGEAYKLDVSPSGVTIAAAQ
RAGLFYGAMSLWQLATPDETKGPVAIPAAVIEDAPRFAWRGLMVDSARHYQSIATLKATL
DAMAAHKLNTFHWHLVDDQGWRLEIKKYPKLTQVGAWRVEPGAARAYPKYGGFYTQDQVR
DLVAYAAARNITIVPEIETPGHALAPIVAYPELGSAPPDASKMGDWGVFPWLYNTDDATF
AFLDDVLNEVMDLFPSTFIHVGGDEAIKDQWKASPKIQAKIKELGLKDEHELQSWFIQRV
GKTLEKRGRRLIGWDEILEGGLAPNATVMSWRGIDGAIAAAKAGHDTVLSPHPTLYLDNR
QSASPDEPTGRGKVVSLKDVYAFDPAPAQLTADQRQHILGVQANVWTEHMQTDARMQAMA
FPRAVALAERGWTPEGGADWSDFARRLPAEMARLKILGVAANTVPFEPQPTLSEGEGGKT
RLALSTGLGLGEIRYTLDGKAPTTVSTPYADELDLPAGTTVKARSFLDGQALGRERSWTL
TPTLLHTRLSAQLKLCTEKVPLTMVDDAPRAFERRAMMFVDILNPCWIWESADLTKGAIL
SVRASQIPFNFQVGADRDRIPLRAPATPGGELEVRAGCAGERLAAIPLGEATKNPGLSTI
TSRLPARRGKVDLCLSFTAKSVDPFWAIDRVTLTPAN
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgaccccgctccgcaccgtcgtcgtctcggctctcgccctggccgccgccttc
gccacgccggcgggcgccgccgacctgaccctcacccccgcgccggccaaggcggtccgc
gccgagggggccttcaagctctccgccgccacccgcatccacgtcgccaagggcgatgtc
gaggcccgaggcgtcgccaaccagctcgccgacctgatccgccgctcgcgcggtttccga
cccgccgtcgtcgaaggcggaccgaccgctggcgccatcgtcctcacccgcgagggccct
tctggcgaagcctacaagctcgacgtctcgccgagcggcgtgaccatcgccgccgcccag
cgcgcgggcctgttctatggcgccatgtctctgtggcagttggcgacgcccgacgagaca
aagggccccgtcgccattccggccgccgtcatcgaggacgccccgcgcttcgcctggcgc
ggcctgatggtcgacagcgcccggcactatcagtcgatcgccacgctgaaggcgacgctc
gacgccatggcggcgcacaagctcaacaccttccactggcacctggtcgacgaccagggt
tggcggctggagatcaagaagtatccgaagctgacgcaggtcggcgcctggcgcgtggag
cccggcgcggcgcgcgcctatccgaagtacggcggcttctacacgcaggaccaggtccgc
gacctcgtcgcctacgccgccgcccgcaacatcaccatcgtccccgagatcgagaccccc
ggccacgccctcgcgccgatcgtcgcctatccggagctcggctcggcgccgcccgatgcg
tcgaagatgggcgactggggagtcttcccgtggctctacaacaccgacgacgcgaccttc
gccttcctcgacgacgtgttgaacgaggtgatggacctcttcccctcgaccttcatccac
gtgggcggcgacgaggcgatcaaggaccagtggaaggccagtcccaagatccaggccaag
atcaaggaactggggctgaaggacgagcacgagctgcagagctggttcatccagcgcgtc
ggcaagaccctcgagaagcgcggccgccggttgatcggctgggacgagattctggagggg
ggcctcgcgcccaacgccacggtgatgtcctggcgcgggatcgacggcgcgatcgccgcg
gccaaggcgggccatgacaccgtgctgtcgccgcacccgacgctgtatctcgacaaccgt
cagagcgcctcgcccgacgagccgaccggccggggcaaggtggtcagcctgaaggatgtc
tacgccttcgaccccgcgccggcccaactgaccgccgaccagcgccagcacatcctcggc
gtccaggccaatgtctggaccgagcacatgcagaccgacgcgcggatgcaggccatggcc
ttcccgcgcgccgtcgccctggccgagcggggctggacgccggagggcggcgccgactgg
agcgacttcgcccgccgcctgcccgccgagatggcgcggctgaagatcctcggcgtcgcc
gccaacaccgtcccgttcgagccgcaaccgacgctgtcggaaggcgaagggggcaagacg
cggctggcgctgtccacggggctcgggcttggcgaaatccgctacacgctcgacggcaag
gcgccgaccacagtctcgacgccttacgccgacgagctggacctgccggcgggaacaacg
gtgaaggcccggtccttcctggacggccaggccctgggccgcgagcgatcgtggaccctc
acgccgaccctgctgcacacccgcctgagcgcgcaactgaagctctgcaccgagaaggtg
cccctgaccatggtcgacgacgccccgcgcgccttcgagcggcgggcgatgatgttcgtc
gacatcctcaatccctgctggatctgggagagcgcggacctcacgaagggcgcgatcctc
agcgtccgcgccagtcagatccccttcaacttccaggtcggcgccgaccgcgaccgcatt
ccgctgcgcgcgcccgcgacgccgggcggcgagcttgaggtgcgcgccggctgcgcgggc
gaacgcctggccgccattccgctgggcgaggcgacgaaaaatccgggcctgtccacgatc
accagccgtttgcccgcgcgtcggggtaaggtcgatctttgcctgagcttcacggccaag
agcgtcgatcccttctgggcgatcgatcgcgtgaccctgacgcccgcgaactag

DBGET integrated database retrieval system