KEGG   Caulobacter segnis: Cseg_3749Help
Entry
Cseg_3749         CDS       T01221                                 

Definition
response regulator receiver modulated chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cse  Caulobacter segnis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cse00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cseg_3749
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Cseg_3749
Enzymes [BR:cse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Cseg_3749
Two-component system [BR:cse02022]
 CheA family
  CheA-CheYBV
   Cseg_3749
Bacterial motility proteins [BR:cse02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Cseg_3749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4111428..4112456)
Genome map
AA seq 342 aa AA seqDB search
MAKIRVLVVDDSATMRSLISAALNRDPEIEVVGGAGDPFEARGMIKTLNPDVVTLDIEMP
NMNGIEFLEKIMRLRPMPVVMVSTLTQAGAEMTLRALELGAVDCVGKPADATGTQEALAE
IVTKVKTAARASVRTKADAAPARAPRKDYMPSGDLVAIGSSTGGVEALLSILQQFPETCP
PTVITQHMPATFTASFAARLDRSSGAKVTEATDGAVLEPGKVYVAPGGATHLEVVRSAGL
RCRLVQGDPVSGHRPSVDVLFNSVAQTLGDKAVGVILTGMGRDGAQGLLAMRKAGARTLG
QDEASCVVYGMPRAAFEIGAVEKQVSLSSMGQSILDLASARR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggctaagattcgcgtactcgtcgtcgatgactccgcaacgatgcggagcctgatttcg
gcggccctgaaccgtgatcccgagatcgaggtcgtcggcggcgctggcgaccccttcgaa
gcccgggggatgatcaagacgctcaacccggacgtcgtcacgctcgacatcgagatgccg
aacatgaacggcatcgagttcctcgaaaagatcatgcgcctgcggccgatgccggtggtc
atggtctcgaccctgacccaggctggcgcggaaatgacgctgcgggccctggaactgggc
gcggtggactgcgtgggcaagccggccgatgcgaccggcacccaggaggcgctggccgag
atcgtcaccaaggtgaagaccgcggcgcgcgcctcggtgcgcaccaaggccgacgccgcg
ccggcccgcgcgccgcgcaaggactatatgccttcgggcgacctggtggccatcggttct
tcgaccggcggggtcgaggcgctgctgtcgatcctgcagcagttccccgagacctgcccg
ccgacggtgatcacccagcacatgccggcgaccttcaccgccagcttcgccgcccgcctt
gatcgctctagcggcgccaaggtgaccgaagcgaccgacggcgcggtgctcgagcccggc
aaggtctatgtcgcccccggcggcgccacgcacctggaggtcgtccgttcggccggcctg
cggtgccgtctggtccaaggcgaccccgtcagcggtcaccgcccgtcggtggacgtgctc
ttcaactcggtcgcccagaccctgggcgacaaggctgtcggcgtgatcctgaccggcatg
ggccgcgatggagctcaaggccttctggccatgcgaaaggccggggcgcgtacgctcggc
caggacgaggctagttgcgtcgtctacggcatgccgcgagccgccttcgaaattggcgcg
gtggagaaacaggtgtccctgtcctccatgggccagtccattctcgatctggcctcggcg
aggcgctga

DBGET integrated database retrieval system