KEGG   Caulobacter segnis: Cseg_3804Help
Entry
Cseg_3804         CDS       T01221                                 

Definition
2-oxoglutarate dehydrogenase E2 subunit dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cse  Caulobacter segnis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cseg_3804
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cseg_3804
  Amino acid metabolism
   00310 Lysine degradation
    Cseg_3804
Enzymes [BR:cse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cseg_3804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4171851..4173083)
Genome map
AA seq 410 aa AA seqDB search
MADIMTPALGESVTEATVARWTKKAGEAVKKDEILVELETDKVSLEVASPADGVLSAIGA
AEGATVVPGTVLGVVTEGGAATAAPAAPKAAEAPKPAPAPAAAPALAPAPAPAAAAPAAA
PVSPAPARIAAETGLDLSKVAGTGKDGRVTKGDALAALEARAAAPAPAAAPAAPRALHER
EERVKMTRLRQTIARRLKEAQNTAAMLTTFNEVDMSAVMALRAQYKDVFEKQHGVKLGFM
SFFTKAVVAALKAIPDVNAEIDGQDIIYKNHYDIGVAVGTDKGLVVPVVRDADVLNLAQI
EKTIGDLGKRARTGQLGIEDMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHAIKERP
MVVNGKIEIRPMMYLALSYDHRVVDGAGAVTFLVKVKEAIEDPQRLLLEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcatgacccccgccctcggcgaatccgtcacggaagcgacggtcgcccgc
tggaccaagaaggccggggaggccgtgaagaaggacgaaatcctcgtcgagctggaaacc
gacaaggtttcgcttgaagtggcctcgcccgccgacggcgtgctgtcggccatcggcgcc
gccgaaggcgcgaccgtcgttccgggcacggtcctgggcgtggtgaccgaaggcggcgcc
gcgaccgccgctccggccgctcccaaggccgccgaagcgcccaagcccgcgccggctccg
gccgccgccccggctctcgctcccgctccggccccggccgccgctgctccggccgccgcg
ccggtcagcccggctccggcccgcatcgccgccgaaaccggcctcgacctgtcgaaggtc
gcgggcaccggcaaggacggccgcgtgaccaagggcgacgccctggccgctctggaagcc
cgcgccgcggctccggccccggccgccgctccggccgcgccgcgcgccctgcacgagcgc
gaggaacgcgtgaagatgacgcgcctgcgtcagacgatcgcccgtcgcctgaaggaagcc
cagaacaccgccgccatgctgacgaccttcaacgaggtcgacatgagcgccgtgatggcc
ctgcgcgcccagtacaaggacgtcttcgaaaagcagcacggcgtgaagctgggcttcatg
tcgttcttcaccaaggccgtcgtggccgcgctgaaggcgatcccggacgtcaacgccgag
atcgacggccaggacatcatctacaagaaccactacgacatcggcgtcgccgtcggcacc
gacaagggcctggtggttccggtcgtccgtgacgccgacgtgctgaacctggcgcagatc
gaaaagacgatcggcgacctgggcaagcgcgcccgcaccggccagctgggcatcgaggac
atgcagggcggcaccttcacgatcaccaacggcggcatctacggttcgctgatgtcgacc
ccgatcctgaacgcgccgcagtcgggcatcctgggcatgcacgccatcaaggaacgtccg
atggtcgtgaacggcaagatcgagattcgcccgatgatgtatctggccctgtcgtacgac
caccgcgtcgtcgacggcgccggcgccgtgaccttcctggtgaaggtcaaggaagccatc
gaagacccgcagcgcctgctgctggagctctaa

DBGET integrated database retrieval system