KEGG   Caulobacter segnis: Cseg_3804Help
Entry
Cseg_3804         CDS       T01221                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cse  Caulobacter segnis
Pathway
cse00020  Citrate cycle (TCA cycle)
cse00310  Lysine degradation
cse01100  Metabolic pathways
cse01110  Biosynthesis of secondary metabolites
cse01120  Microbial metabolism in diverse environments
cse01130  Biosynthesis of antibiotics
cse01200  Carbon metabolism
Module
cse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cseg_3804
  Amino acid metabolism
   00310 Lysine degradation
    Cseg_3804
Enzymes [BR:cse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cseg_3804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADG12225
UniProt: D5VP02
Position
complement(4171851..4173083)
Genome map
AA seq 410 aa AA seqDB search
MADIMTPALGESVTEATVARWTKKAGEAVKKDEILVELETDKVSLEVASPADGVLSAIGA
AEGATVVPGTVLGVVTEGGAATAAPAAPKAAEAPKPAPAPAAAPALAPAPAPAAAAPAAA
PVSPAPARIAAETGLDLSKVAGTGKDGRVTKGDALAALEARAAAPAPAAAPAAPRALHER
EERVKMTRLRQTIARRLKEAQNTAAMLTTFNEVDMSAVMALRAQYKDVFEKQHGVKLGFM
SFFTKAVVAALKAIPDVNAEIDGQDIIYKNHYDIGVAVGTDKGLVVPVVRDADVLNLAQI
EKTIGDLGKRARTGQLGIEDMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHAIKERP
MVVNGKIEIRPMMYLALSYDHRVVDGAGAVTFLVKVKEAIEDPQRLLLEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcatgacccccgccctcggcgaatccgtcacggaagcgacggtcgcccgc
tggaccaagaaggccggggaggccgtgaagaaggacgaaatcctcgtcgagctggaaacc
gacaaggtttcgcttgaagtggcctcgcccgccgacggcgtgctgtcggccatcggcgcc
gccgaaggcgcgaccgtcgttccgggcacggtcctgggcgtggtgaccgaaggcggcgcc
gcgaccgccgctccggccgctcccaaggccgccgaagcgcccaagcccgcgccggctccg
gccgccgccccggctctcgctcccgctccggccccggccgccgctgctccggccgccgcg
ccggtcagcccggctccggcccgcatcgccgccgaaaccggcctcgacctgtcgaaggtc
gcgggcaccggcaaggacggccgcgtgaccaagggcgacgccctggccgctctggaagcc
cgcgccgcggctccggccccggccgccgctccggccgcgccgcgcgccctgcacgagcgc
gaggaacgcgtgaagatgacgcgcctgcgtcagacgatcgcccgtcgcctgaaggaagcc
cagaacaccgccgccatgctgacgaccttcaacgaggtcgacatgagcgccgtgatggcc
ctgcgcgcccagtacaaggacgtcttcgaaaagcagcacggcgtgaagctgggcttcatg
tcgttcttcaccaaggccgtcgtggccgcgctgaaggcgatcccggacgtcaacgccgag
atcgacggccaggacatcatctacaagaaccactacgacatcggcgtcgccgtcggcacc
gacaagggcctggtggttccggtcgtccgtgacgccgacgtgctgaacctggcgcagatc
gaaaagacgatcggcgacctgggcaagcgcgcccgcaccggccagctgggcatcgaggac
atgcagggcggcaccttcacgatcaccaacggcggcatctacggttcgctgatgtcgacc
ccgatcctgaacgcgccgcagtcgggcatcctgggcatgcacgccatcaaggaacgtccg
atggtcgtgaacggcaagatcgagattcgcccgatgatgtatctggccctgtcgtacgac
caccgcgtcgtcgacggcgccggcgccgtgaccttcctggtgaaggtcaaggaagccatc
gaagacccgcagcgcctgctgctggagctctaa

DBGET integrated database retrieval system