KEGG   Caulobacter segnis: Cseg_3804Help
Entry
Cseg_3804         CDS       T01221                                 

Definition
2-oxoglutarate dehydrogenase E2 subunit dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cse  Caulobacter segnis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:cse01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cse00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cse00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4171851..4173083)
Genome map
AA seq 410 aa AA seqDB search
MADIMTPALGESVTEATVARWTKKAGEAVKKDEILVELETDKVSLEVASPADGVLSAIGA
AEGATVVPGTVLGVVTEGGAATAAPAAPKAAEAPKPAPAPAAAPALAPAPAPAAAAPAAA
PVSPAPARIAAETGLDLSKVAGTGKDGRVTKGDALAALEARAAAPAPAAAPAAPRALHER
EERVKMTRLRQTIARRLKEAQNTAAMLTTFNEVDMSAVMALRAQYKDVFEKQHGVKLGFM
SFFTKAVVAALKAIPDVNAEIDGQDIIYKNHYDIGVAVGTDKGLVVPVVRDADVLNLAQI
EKTIGDLGKRARTGQLGIEDMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHAIKERP
MVVNGKIEIRPMMYLALSYDHRVVDGAGAVTFLVKVKEAIEDPQRLLLEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcatgacccccgccctcggcgaatccgtcacggaagcgacggtcgcccgc
tggaccaagaaggccggggaggccgtgaagaaggacgaaatcctcgtcgagctggaaacc
gacaaggtttcgcttgaagtggcctcgcccgccgacggcgtgctgtcggccatcggcgcc
gccgaaggcgcgaccgtcgttccgggcacggtcctgggcgtggtgaccgaaggcggcgcc
gcgaccgccgctccggccgctcccaaggccgccgaagcgcccaagcccgcgccggctccg
gccgccgccccggctctcgctcccgctccggccccggccgccgctgctccggccgccgcg
ccggtcagcccggctccggcccgcatcgccgccgaaaccggcctcgacctgtcgaaggtc
gcgggcaccggcaaggacggccgcgtgaccaagggcgacgccctggccgctctggaagcc
cgcgccgcggctccggccccggccgccgctccggccgcgccgcgcgccctgcacgagcgc
gaggaacgcgtgaagatgacgcgcctgcgtcagacgatcgcccgtcgcctgaaggaagcc
cagaacaccgccgccatgctgacgaccttcaacgaggtcgacatgagcgccgtgatggcc
ctgcgcgcccagtacaaggacgtcttcgaaaagcagcacggcgtgaagctgggcttcatg
tcgttcttcaccaaggccgtcgtggccgcgctgaaggcgatcccggacgtcaacgccgag
atcgacggccaggacatcatctacaagaaccactacgacatcggcgtcgccgtcggcacc
gacaagggcctggtggttccggtcgtccgtgacgccgacgtgctgaacctggcgcagatc
gaaaagacgatcggcgacctgggcaagcgcgcccgcaccggccagctgggcatcgaggac
atgcagggcggcaccttcacgatcaccaacggcggcatctacggttcgctgatgtcgacc
ccgatcctgaacgcgccgcagtcgggcatcctgggcatgcacgccatcaaggaacgtccg
atggtcgtgaacggcaagatcgagattcgcccgatgatgtatctggccctgtcgtacgac
caccgcgtcgtcgacggcgccggcgccgtgaccttcctggtgaaggtcaaggaagccatc
gaagacccgcagcgcctgctgctggagctctaa

DBGET integrated database retrieval system