KEGG   Caulobacter segnis: Cseg_3807Help
Entry
Cseg_3807         CDS       T01221                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cse  Caulobacter segnis
Pathway
cse00020  Citrate cycle (TCA cycle)
cse00640  Propanoate metabolism
cse00660  C5-Branched dibasic acid metabolism
cse01100  Metabolic pathways
cse01110  Biosynthesis of secondary metabolites
cse01120  Microbial metabolism in diverse environments
cse01130  Biosynthesis of antibiotics
cse01200  Carbon metabolism
Module
cse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cseg_3807
   00640 Propanoate metabolism
    Cseg_3807
   00660 C5-Branched dibasic acid metabolism
    Cseg_3807
Enzymes [BR:cse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cseg_3807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ADG12228
UniProt: D5VP05
Position
complement(4177167..4178366)
Genome map
AA seq 399 aa AA seqDB search
MNIHEHQAKAVLAEFGAPVPRGFAAFTPDEAAAAAEKLGGPVFVVKSQIHAGGRGKGKFE
GLGPDAKGGVRVVKSVEEVKTNAAEMLGRVLVTHQTGPKGKQVNRLYIEEGAAIAKEFYL
SLLVDRASSKVSVVASTEGGMDIEDVAHSTPEKIHTFTIDPATGVWPTHQRALAKALGLT
GGLAKEAASLLTQLYTAFMAKDMAMLEINPLIVTADDHLRVLDAKLSFDGNSLFRHPDIK
ALRDESEEDPKEIEASKYDLAYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPAVKGILVNIFGGIMRCDIIAEGVIAAVKEVGLKVPLVVRLE
GTNVELGKKIISESGLNVIAANDLSDGAEKIVAAVKGAR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaacatcaagccaaagccgtactcgccgagttcggcgcccccgtgccg
cgcggcttcgccgccttcacgcccgatgaagccgccgccgccgctgaaaagctgggcggg
ccggtcttcgtcgtgaagagccagatccacgccggcggccgcggcaagggcaagttcgag
ggcctcggccccgacgccaagggcggcgtgcgcgtcgtcaagtcggtcgaagaggtcaag
accaacgccgccgaaatgctcggccgcgtgctggtgacccaccagacgggccccaagggc
aagcaggtcaaccgcctctacatcgaggaaggcgcggcgatcgccaaggaattctacctg
tcgcttctcgtcgaccgcgcctcgagcaaggtctcggtcgtcgcctcgaccgaaggcggc
atggacatcgaggacgtcgctcactcgacgcccgagaagatccacaccttcaccatcgac
ccggcgacgggcgtgtggccgacccaccagcgcgccctggccaaggctctgggcctgacc
ggcggtctggccaaggaagccgcctcgctgctgacccagctctatacggcgttcatggcc
aaggacatggccatgctggagatcaacccgctgatcgtgaccgcggatgatcacctgcgc
gtcctggacgccaagctgtcgttcgacggcaacagcctgttccgtcacccggacatcaag
gcgctgcgcgacgagagcgaagaagaccccaaggaaatcgaagcctcgaagtacgacctg
gcctacatcgccctcgacggcgaaatcggctgcatggtcaacggcgcgggcctggccatg
gccaccatggacatcatcaagctgtacggcgctgagccggccaacttcctcgatgtcggc
ggcggcgccagcaaggagaaggtcaccgcggccttcaagatcatcaccgccgatccggcc
gtgaagggcatcctggtcaacatcttcggcggcatcatgcgctgcgacatcatcgcggaa
ggcgtcatcgccgccgtgaaggaagtcggcctgaaggttccgctggtcgtccgtctggaa
ggcaccaacgtcgagctcggcaagaaaatcatctcggaaagcggcctgaacgtcatcgcc
gccaacgatctgtctgacggcgccgagaagatcgtcgccgctgtgaagggcgcccgctaa

DBGET integrated database retrieval system