KEGG   Caulobacter segnis: Cseg_3842Help
Entry
Cseg_3842         CDS       T01221                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cse  Caulobacter segnis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cseg_3842
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cseg_3842
Enzymes [BR:cse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cseg_3842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4216203..4217333
Genome map
AA seq 376 aa AA seqDB search
MSHAAEAYRSARRIVFKVGSALLVDDATGAADRAWLEAFCADAAALRADGKQVLVVSSGA
VALGRRRLGLTGRKATLPEKQAAAAAGQSLLMRAWEEAFEPHGLGVAQILLTRDDTETRR
RWLNARATTETLMGLGVVPVVNENDTVVTEEIRYGDNDRLAARVAQMAGADLLVLLSDID
GLYTADPRKNPKAQHIPHVSEITAEIAGMADGANAAAGVGTGGMATKIAAARIARAAGCA
TLITLGSRPRPLAAIAAGEKATLIEAGASPAAAYKAWIAGSLAPQGWVTVDAGAAKALEA
GKSLLSAGVRAIEGPFEKGDAVRVRDETGREVARGIVRYDSADAQRIAGLRSDAIEAELG
FTEGPMIHADDLAVAH
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgagccacgccgccgaggcgtatcgcagcgcccgccgcatcgtcttcaaggtcggctcg
gccctgctggtcgacgacgcgaccggcgcggctgaccgcgcctggctggaagcgttctgc
gccgacgccgctgctctacgcgcggacggcaaacaggtgctggtggtctcgtcgggcgcc
gtggcgctcggtcgtcgacgcctgggcctaaccggccgcaaggccaccttgccggaaaag
caggccgcggccgccgccggccagtcgctgctgatgcgcgcctgggaggaagccttcgag
ccgcatggtctcggcgtcgcccagatcctgctgacccgcgacgacaccgagacccgccgc
cgctggctgaacgcccgcgccacgaccgagacgctgatgggcctgggcgtcgtgccggtg
gtcaacgagaacgacaccgtcgtcaccgaggaaatccgctacggcgacaacgaccgcctg
gccgcgcgcgtggcccagatggcgggcgcggacctcctggtgctgctgtcggacatcgac
ggcctctacaccgccgacccgcgcaagaaccccaaggcccagcacatcccgcacgtgagc
gagatcacggccgagatcgccggcatggccgacggcgccaacgccgccgctggcgtcggc
accggcggcatggccaccaagatcgccgccgcccgcatcgcccgcgccgccggctgcgcc
accctgatcacgctgggctcgcgcccgcgcccgctggccgccatcgccgccggcgagaag
gcgaccctgatcgaggccggcgccagtccggccgccgcctacaaggcctggatcgccggc
tcgctggcgccgcaaggctgggtcacggtcgacgccggcgcggccaaggcgctggaggcg
ggcaagagcctgctgtcagccggcgtccgcgccatcgagggtccgttcgagaagggcgac
gccgtccgcgtccgcgacgagaccggccgcgaggtcgcgcgcggcatcgtccgctacgac
agcgccgacgcccagcgcatcgccggcctgcgctccgacgccatcgaggccgaactcggt
ttcacggagggcccgatgatccacgccgacgacctggccgtagcccactag

DBGET integrated database retrieval system