KEGG   Caulobacter segnis: Cseg_3882Help
Entry
Cseg_3882         CDS       T01221                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cse  Caulobacter segnis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cse01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cse00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4260005..4261165)
Genome map
AA seq 386 aa AA seqDB search
MNSPAPVSVSIDPVELAQALIRRPSVTPADAGAMDTLQRQLEALGFACRRMTFGEIENLY
ARRGTARPNLCFAGHTDVVPVGDDAAWTAGPFEAEIKDGILFGRGAVDMKSAIAAFVAAV
ANVPDHAGSISFLITGDEEGVAEDGTVKVVEALAAEGEIIDHCIVGEPTSANVLGDMVKI
GRRGSINAWIAVDGKQGHVAYPHRAANPIPVMVDILSRLQSRVLDEGYTGFQPSNLEVTT
VDVGNTATNVIPASAKARVNIRFNPAHKGKDLAAWIERECREAAEGFSGRVEALCKISGE
AFLTEPGAFTDVIVAAVGDATGRVPELSTTGGTSDARFIRALCPVVEFGLVGSTMHQVDE
RVPVEEVRQLAGAYEALINRYFAAFA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccccgcgcccgtttccgtcagcatcgatcctgtcgaactcgcccaggccctg
atccggcgtccgtcggtgaccccggccgacgcgggcgcgatggacacgctgcagcgccag
ctggaggccctgggcttcgcctgccgccgcatgacgttcggcgagatcgagaacctctac
gcccggcgcgggaccgcgcggccgaacctctgcttcgccggccataccgacgtggtgccg
gtcggcgacgacgcggcctggaccgccggtcccttcgaggccgagatcaaggacgggatc
ctctttggccgaggcgcggtcgacatgaagtccgccatcgccgcctttgtcgccgccgtc
gcgaacgttcccgaccatgccggctcgatcagcttcctgatcaccggcgacgaggagggc
gtggccgaggacgggaccgtcaaggtcgtcgaggccctggccgccgagggcgagatcatc
gaccactgcatcgtcggcgagccgaccagcgccaacgtgctgggcgacatggtcaagatc
ggccggcgcggcagcatcaacgcctggatcgccgtggacggtaagcaggggcacgtggcc
tacccgcatcgcgccgccaacccgatcccggtgatggtcgacatcctctcgcgcctgcag
agccgggtgctggacgagggctataccggcttccagccgtcgaatctggaggtgaccacg
gtggacgtcggcaacaccgccaccaacgtcatccccgcttcggccaaggcgcgggtgaac
atccgcttcaacccggcccacaagggcaaggacctggccgcctggatcgagcgggagtgc
cgcgaggccgcggagggcttctcgggccgggtcgaggcgctgtgcaagatcagcggcgag
gccttcctgaccgaaccgggcgccttcaccgacgtgatcgtggccgcggtcggcgacgcg
accggccgcgtgcccgaactgtcgacgaccggcggcaccagcgacgcccgcttcatccgc
gcgctctgccccgtcgtcgagttcggtctggtcggctcgaccatgcaccaggtcgacgag
cgggtcccggtcgaggaggtccgccagctggccggcgcctacgaggccctgatcaaccgc
tatttcgcggccttcgcctga

DBGET integrated database retrieval system