KEGG   Caulobacter segnis: Cseg_3984Help
Entry
Cseg_3984         CDS       T01221                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cse  Caulobacter segnis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cseg_3984
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cseg_3984
   00052 Galactose metabolism
    Cseg_3984
   00500 Starch and sucrose metabolism
    Cseg_3984
   00520 Amino sugar and nucleotide sugar metabolism
    Cseg_3984
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cseg_3984
   00524 Butirosin and neomycin biosynthesis
    Cseg_3984
Enzymes [BR:cse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cseg_3984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4376536..4377498)
Genome map
AA seq 320 aa AA seqDB search
MIVSQEKTAYALVADVDGEKARIGLAEPGRAPVDVGVVDCDSQEALIEILSRALAEAPGP
ILGVAIAAPGPSLNGAIKLTHAPMRLVAESIAAGLGIHRLRLVNDFTARALAVPLLDHGA
LESIGAGAPHRDAPAGAIGPSETGVGMSILYPDGFVGWTAAAAEGGHADLAAASDREAAV
IRLLRDTYGHVSADKVLCGNGLLDVALALSTLAGAPARPDNAQALIAAAEREEPVARETF
ALVSAWLGAVCGNLVLTVGARSGIYIISATVLSWGRHLDRQILRRRFEAKGQMADYMRDV
PLYLVNDPNCGLLGLSTLFS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgtcgcaagaaaaaacggcctacgcgctcgtcgccgacgttgacggcgaaaag
gcccgtattggtctggccgagccgggccgggcgccagtcgacgtcggcgttgtcgactgc
gacagccaggaggcgctcatcgagatcctctcgcgagccctggctgaagcgccgggcccc
attctcggcgtcgccatcgccgcgccgggccccagtctcaatggggcgatcaagcttacc
cacgccccgatgcgccttgtggccgagagcatagcggccgggcttgggatccatcgacta
cgcctggtcaacgacttcaccgcccgggccttggccgtgccgttgctggatcacggcgct
ctggagtccataggagcaggggcgccccatcgcgacgcgccggcgggagccatcgggccg
tccgaaaccggcgtgggcatgtcgatactttaccccgacggtttcgtcgggtggaccgcc
gcagccgccgagggcgggcacgccgacctcgccgcggccagtgatcgtgaagctgctgtg
attaggcttctgcgcgacacatacggccacgtctccgccgacaaggtgctttgcggcaat
ggcttgcttgacgtggcgcttgccctgtcgacgctggctggagccccggcgcgccccgac
aacgcgcaggcgctgatcgcggccgctgagcgagaggaacccgtggcgcgcgagacgttc
gctctggtgtcggcgtggcttggcgccgtctgcggcaatcttgtcctgaccgttggcgcc
aggagcggcatctacattatcagcgcgaccgtcctgtcatggggacgccatctcgaccgc
cagatcctgcgtcgccggttcgaagcgaaggggcagatggccgactatatgcgcgacgtt
ccgctatatctcgtcaacgacccgaactgcggcttgctgggtctgagcacccttttcagt
taa

DBGET integrated database retrieval system