KEGG   Caulobacter segnis: Cseg_4027Help
Entry
Cseg_4027         CDS       T01221                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cse  Caulobacter segnis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Cseg_4027
Enzymes [BR:cse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Cseg_4027
Transfer RNA biogenesis [BR:cse03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Cseg_4027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4421372..4422166)
Genome map
AA seq 264 aa AA seqDB search
MSETATTENLADWGRALARITEEAATVILPFWRTELAVAQKADESPVTEADRAGERLILQ
RLAEAFPDVTVISEEHASEFGTPDAIGSRFFLVDPVDGTKAFVRGDPNFTVNIGLIDHGV
PVAGAVCAPATGEVWYTTAAGATKRMGADAPEAAARVRPWPTGRALGLISHTMREEKAAE
LAAEYGFDLRTAMDSSIKMCRIAEGSADIYPRHGPTSEWDTAAAHAVLVAAGGTFTQPDG
SPFVYGKADQGFRNGWFVARGGAA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaccgcgacgaccgaaaacctggccgactggggccgagccctggccaggatc
accgaagaggcggcgacggtcatcctcccgttctggagaacggaattggcggtggcgcag
aaggcggacgaaagccccgtcaccgaggcggatcgcgcgggcgagcggctgatcctgcag
cgcttggcggaggcgtttccggatgtcaccgtgatttccgaggagcacgccagtgagttc
gggacgcccgacgccatcggatcgcgtttcttcctcgtcgaccccgtcgacggcaccaaa
gccttcgttcgcggcgacccgaacttcaccgtcaatatcggcctgatcgaccatggcgtt
ccggtcgccggcgccgtctgcgcgccggccacgggcgaggtctggtacaccacggccgcg
ggcgcgacgaaacgtatgggcgctgatgctccagaggcggcggcgcgggtccggccgtgg
ccgaccggtcgggccttgggcttgatcagtcacaccatgcgcgaggaaaaggccgccgag
ctcgccgccgagtacggctttgaccttcgcacggccatggattcctcgatcaagatgtgc
cggatcgccgaaggctcggccgacatctatccgcgtcacgggccgacgtccgaatgggac
accgccgccgcccacgcggttctggtcgccgccggcggaaccttcacccagccggacggc
tcacccttcgtctatggcaaggccgaccaaggcttccgaaatggttggttcgtggcgcgc
ggcggcgcggcttga

DBGET integrated database retrieval system