KEGG   Cynoglossus semilaevis (tongue sole): 103384991Help
Entry
103384991         CDS       T04866                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:csem00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    103384991 (mgll)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103384991 (mgll)
Peptidases [BR:csem01002]
 Serine Peptidases
  Family S33
   103384991 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
10
AA seq 367 aa AA seqDB search
MCFSVDESVFCACWDYNRHIPNRLILSSQTLPIVGIMRAVTAATCLLAAGLSCFFYGSDV
LPLLGGLSLSDPASMPERRSPQGVLYTDLQHIVNADGLHLFCRYWEPVEPPRALVFIVHG
TGEHSGPYDEIAQKLRDQSLLVFAHDHVGHGQSEGERMNVKDFQVYIRDSLQHIDLMKSR
HPDLPVFILGHSMGGAVAILTACERPSDFAGVVLIAPMIKMNPESATPFKVFLAKVLNHV
LPRLPLGSINSKWVSRDKSKVEAYDADDLNHHGGVRVSFGWQLMGAAARIEKEIPTISWP
FFLLHGDADKLCDIRGSKIMFDKAPSPDKKIKIYEGGYHALHLDLPDVAQSVLKEVSAWI
TEHLPLN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttttctgttgacgagagtgtgttttgtgcatgttgggattataaccgacatatt
cctaaccgactaatcctgtcatcgcaaacattgcctatagtcggaataatgcgtgcggtg
accgccgccacctgcctgctcgccgccggcttaagctgctttttctacggcagcgacgta
ttaccgctgctcggtggtttgtctctttcagacccagcatccatgccggagcggcggagc
ccgcagggagtcctgtacacggacctccagcacattgtcaacgccgacggactgcacctg
ttctgccgctactgggagcctgtggagccgccaagggctctggtgtttatcgtccatggc
accggggagcattctgggccgtatgatgagattgcacaaaaactgagggaccagtctttg
ctggtatttgcacacgaccacgtgggccacggtcaaagtgaaggagaaagaatgaacgtc
aaagacttccaggtttacatcagagactcactgcagcacattgacctgatgaagtcccgt
cacccagacctaccagtcttcattctaggtcactccatgggcggcgccgtggccatcctc
acagcctgtgaaaggcccagtgattttgctggcgtggttctgatcgcaccgatgatcaaa
atgaacccagaatctgcaacgccgttcaaagtttttctggctaaggtcctgaaccacgtg
ctgcccagactccctctgggcagcatcaattccaaatgggtttcccgggacaagtcaaag
gtggaggcctatgacgcagacgacctgaaccaccacggtggggtcagggtgtcgttcggg
tggcagctgatgggggctgcggctcgcatagagaaggaaatcccgaccatcagctggccg
ttctttctcctgcacggtgacgccgacaaactctgtgacatcagaggttctaagatcatg
tttgacaaggctccaagtccagacaagaagatcaagatctatgagggaggctaccacgcc
ctccatctggacctgcccgacgtggcccagtccgtgctgaaggaagtgtcggcctggatc
acagagcacctgcccctgaactaa

DBGET integrated database retrieval system