KEGG   Cynoglossus semilaevis (tongue sole): 103386668Help
Entry
103386668         CDS       T04866                                 

Gene name
abhd6
Definition
(RefSeq) monoacylglycerol lipase ABHD6 isoform X1
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103386668 (abhd6)
Peptidases [BR:csem01002]
 Serine Peptidases
  Family S33
   103386668 (abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
11
AA seq 342 aa AA seqDB search
MFAVMEMIVPALIISGCCVVLPLSLFFVTFFLWPAAIIKAYNWNERRKMRLVVHNSFSGS
YRFSYFSNVTPGGSTPSLLLLHGFSDKKDSWLPLIKYLPKNQHIVAVDMPGHGGTSRPDG
EDYSIEGQVVRIHQFVQSIGLNKRPFHLVGISMGGNVAGVYAARYPAHLSGVTLICPSGI
DYPTDSEFISQLRELEHSHDINSVALVPKTVDEFENMLRLCCHTQLNIPRQIINGILSER
IPNNEFYKEVLMEIVSETSRYSLQDKLHLISTPLQVIWGKEDKLLDVSGTTVVQAALPCS
QVELLDNCGHNVPMERPRKSAKLIMDFMTACKFSINDDKKHS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagtgatggagatgattgttcctgcgttgataatctcagggtgttgtgttgtg
cttcctctcagcctcttctttgtcacttttttcttatggcctgcagcgatcatcaaagcc
tataactggaatgagcgacgcaaaatgcggttggtggtccacaactctttcagtggaagt
taccgcttcagttatttcagcaatgtaacaccaggtggctccacaccatcgctgctcctg
ctgcatggcttttctgataagaaggattcctggctccccctcatcaagtacctccctaaa
aatcaacacatagttgctgtggacatgccaggacatggggggacgagtcgccccgatggt
gaggactacagcatcgagggacaggtcgtcaggatccatcagtttgtacagagtattggt
ctaaataaaagacccttccatctggtcgggatatcgatgggtgggaatgtggcaggagtc
tatgctgccaggtaccctgcccacctgtcaggggttacgttgatttgtccatcaggcata
gattatcccacagactctgagtttatcagtcagctgagagaactggaacacagtcacgac
attaactctgttgctctggttccaaaaactgttgatgagttcgaaaatatgttgagactc
tgctgtcacactcaactcaacattcccagacagatcatcaatgggatcttgagtgaaagg
attccaaacaatgaattttacaaagaagtgttgatggaaattgtcagtgagacctctagg
tactcattacaagataaactacatctgatcagtacaccactgcaggttatctgggggaag
gaggacaagttgctggatgtttctggaacaacagtggtgcaggctgcactgccttgcagc
caggtggagctgttagacaactgtggtcacaatgtaccaatggagcggcccagaaaatca
gcaaagctcattatggacttcatgacggcatgcaaatttagcataaatgatgataagaaa
cattcttga

DBGET integrated database retrieval system