KEGG   Cynoglossus semilaevis (tongue sole): 103387501Help
Entry
103387501         CDS       T04866                                 

Gene name
abhd12
Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103387501 (abhd12)
Peptidases [BR:csem01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   103387501 (abhd12)
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   103387501 (abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
12
AA seq 361 aa AA seqDB search
MKRRIVKHSDSTSSGVEAAQRRRVQQQEKGSASRWWLKRGLWALIVAFIFVPFSLRVLPE
FIQHFAHTYRVRLPFFLDLSRPAELSLNHTINMYLTSEEGISLGVWHTIPESQWKEAQGK
DLAWYQSTLSNGRPVFIYLHGNTGTRAAPHRVGVAKVLSALGHHVLVPDYRGFGDSTGEP
TEAGLNTDALYVFNWVKSRCGNCQVVIWGHSLGTGVATNIAVKLIEQGVVLDGVILEGAF
NAAPQHEIEHPFSWYYWKFPGIGYLFPLPWADNKLAFTSEENLKNIRSPILFLHSEDDHI
VPIQSPQKMYEVAVSTQNKERVKMVTFDGSLGYLHNGLYRDPQLPDIIKNFVQLLQHLSK
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggaggatcgtcaaacatagtgactcaacgtcttccggggtagaagcagctcag
aggaggagagttcagcagcaggagaaaggatcagcgtccagatggtggctgaaaagaggc
ttatgggccctgattgttgccttcatttttgttccattctccctgcgtgttctcccagag
ttcattcagcattttgctcacacttacagagtccggctgccgttctttcttgacctcagc
cgacctgctgagctctcccttaatcacaccatcaacatgtacttaacatcagaggaagga
atctccctcggcgtatggcacacaatccctgaaagtcagtggaaggaggcacaaggcaag
gacttggcatggtaccagagcactttaagcaatggaaggccagttttcatatatcttcat
gggaacacaggcactagggcagcccctcatcgagtgggagtggcaaaagtattgagtgct
cttggtcatcatgtgctggtaccagactacagagggtttggagattccactggggagccg
acggaggcaggtttgaacactgatgccctctatgtgttcaactgggtcaaatcacgctgt
ggcaactgccaggtggtcatctggggacactcactgggaactggtgtggccaccaacatt
gcagtaaaactaattgagcaaggtgtagttctcgatggtgtgatcttggagggggcgttt
aatgctgctcctcagcatgagatagaacatccattttcatggtattactggaaatttcca
ggcattggatatttgttcccattgccatgggcagacaacaagcttgcctttaccagtgaa
gaaaatttaaaaaacataagaagcccgatacttttccttcactcagaggatgatcacata
gtgcctattcagagccctcaaaagatgtacgaggttgcggtgagcacgcagaataaggag
cgagtcaagatggtgacatttgatggttctctgggatatttgcacaacggactgtataga
gacccccaactgcctgatatcataaagaattttgtgcagttactccagcatctgagtaaa
gactga

DBGET integrated database retrieval system