KEGG   Comamonas serinivorans: CCO03_09645Help
Entry
CCO03_09645       CDS       T04892                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cser  Comamonas serinivorans
Pathway
cser00071  Fatty acid degradation
cser00072  Synthesis and degradation of ketone bodies
cser00280  Valine, leucine and isoleucine degradation
cser00310  Lysine degradation
cser00362  Benzoate degradation
cser00380  Tryptophan metabolism
cser00620  Pyruvate metabolism
cser00630  Glyoxylate and dicarboxylate metabolism
cser00640  Propanoate metabolism
cser00650  Butanoate metabolism
cser00900  Terpenoid backbone biosynthesis
cser01100  Metabolic pathways
cser01110  Biosynthesis of secondary metabolites
cser01120  Microbial metabolism in diverse environments
cser01130  Biosynthesis of antibiotics
cser01200  Carbon metabolism
cser01212  Fatty acid metabolism
cser02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cser00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCO03_09645
   00630 Glyoxylate and dicarboxylate metabolism
    CCO03_09645
   00640 Propanoate metabolism
    CCO03_09645
   00650 Butanoate metabolism
    CCO03_09645
  Lipid metabolism
   00071 Fatty acid degradation
    CCO03_09645
   00072 Synthesis and degradation of ketone bodies
    CCO03_09645
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCO03_09645
   00310 Lysine degradation
    CCO03_09645
   00380 Tryptophan metabolism
    CCO03_09645
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCO03_09645
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCO03_09645
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCO03_09645
Enzymes [BR:cser01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCO03_09645
Exosome [BR:cser04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCO03_09645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ARU04911
UniProt: A0A1Y0ENA5
Position
2260558..2261736
Genome map
AA seq 392 aa AA seqDB search
MEDVVIVSAVRTAIGKFGGSLAKVPATALGATVIKAALERAQLKPEQVSEVIMGQVLAAG
VGQNPARQALIHAGVSKDAPALTINAVCGSGLKAVMLAYQSIVSGDNEIVVAGGQENMSA
SPHVLNGSRDGQRMGDWKMTDTMIVDGLWDVYNQYHMGITAENVAKQEHVTREQQDALAL
ASQQKAAAAQAAGKFKDEIVPVHVPQRKGDPLVFEQDEFINAKTSAEALAGLRPAFDKSG
TVTAGNASGINDGAACVVVMSAKKAAELGLKPLARIAGFATTGLDPATMGLGPVPATQKA
LKRAGWTVGDVDLFELNEAFAAQACAVNNLLGVDPAKVNVNGGAIALGHPIGASGCRVLV
TLLHEMARRDVKRGVAALCIGGGMGVSLAVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgtggtcattgtgtcggcagtgcgcactgccatcggcaagttcggcggcagc
ctggccaaggtgccggcaacggcgctgggcgccacggtgatcaaggccgccctggagcgc
gcccagctcaagcccgagcaggtgagcgaggtcatcatgggccaggtgctggcggcaggt
gtggggcaaaaccccgcacgccaggccttgatccatgccggggtgtccaaggatgcgccg
gcgctcaccatcaacgctgtgtgcggctcggggctcaaggccgtcatgctggcctaccag
tccatcgtgagcggcgacaacgagatcgtggtggcgggcgggcaggaaaacatgagcgcc
tcgccccatgtgctcaacggctcgcgcgatggccagcgcatgggggactggaagatgacc
gacaccatgatcgtggacggtctgtgggacgtgtacaaccagtaccacatgggcatcacc
gccgagaacgtcgccaagcaagagcacgtcacgcgcgagcagcaggatgccctggccctg
gccagccagcaaaaggccgcagctgcccaggccgccggcaagttcaaggatgagatcgtt
ccggtccacgtgccgcagcgcaagggcgacccgctggtgttcgagcaggacgagttcatc
aacgccaagacctcggccgaagccctggcgggcctgcgtcccgctttcgacaagtcgggc
accgtcacggctggcaacgcttccggcatcaacgacggcgccgcctgcgtggtcgtcatg
tcggccaagaaggcggccgagctgggcctcaagcccctggcccgcattgccggtttcgcc
accacgggcctggatccggccaccatggggctgggccccgtgcctgccacccagaaggcc
ctcaagcgcgccggctggaccgtgggcgacgtcgacctgttcgagctcaacgaagccttc
gcggcacaggcctgcgccgtcaacaacctgctgggcgtggacccggccaaggtgaacgtg
aacggcggcgccattgccctgggtcaccccatcggtgcctcgggttgccgcgtgctggtc
acgctcttgcatgagatggcacgccgagatgtcaagcgcggcgtggcggccctgtgcatc
ggcgggggcatgggggtttcgctggcggtggagcgctga

DBGET integrated database retrieval system