KEGG   Cylindrospermum stagnale: Cylst_0094Help
Entry
Cylst_0094        CDS       T02398                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
csg  Cylindrospermum stagnale
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:csg00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97552..98166
Genome map
AA seq 204 aa AA seqDB search
METLRLYDFLLSGNCYKIRLLLTQMGMPFERVEVNIINGETRTTEFFSKNPNGKVPLLEI
EPGQYLAESNAILVYLSEGTEFLPYDRFLRAQVLQWLFFEQYSHEPFIATSRFWISILGK
AEEYHEAIKQKSEPGYAALKVMENHLKSHTFFVAERYTIADIALFAYTHVADEGGFDLTQ
FPAIQAWIERVKAESRHITITQEV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgctgcgcttgtacgattttttactttcaggtaattgttataaaatacgtctt
ctattgacacaaatgggtatgccctttgagagggtagaagttaacatcatcaacggcgag
actcgaacaacagaatttttcagcaaaaatcccaacgggaaagttcccctgttggaaatt
gaaccagggcaatacttggcagaatccaacgctattttggtgtatctgagtgaaggcacc
gaatttttaccctatgaccgctttttacgagcgcaagtattgcaatggttattttttgag
cagtacagccatgaacctttcatcgctacatcaagattttggatttctattttaggtaag
gctgaagaatatcatgaagccatcaagcaaaaaagtgaaccgggttatgcagcacttaaa
gtgatggaaaaccatttaaaatctcacactttttttgtggcggagcgttatactatcgcc
gatatcgccttgtttgcttacactcatgtagccgatgagggtggatttgatttgacacaa
tttcccgctattcaagcttggatagaacgagtcaaagctgagtcgagacatatcactatt
actcaggaagtttaa

DBGET integrated database retrieval system