KEGG   Cylindrospermum stagnale: Cylst_0094Help
Entry
Cylst_0094        CDS       T02398                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cylst_0094
Enzymes [BR:csg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Cylst_0094
Transporters [BR:csg02000]
 Other Transporters
  Pores ion channels [TC:1]
   Cylst_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AFZ22472
UniProt: K9WSF2
Position
97552..98166
Genome map
AA seq 204 aa AA seqDB search
METLRLYDFLLSGNCYKIRLLLTQMGMPFERVEVNIINGETRTTEFFSKNPNGKVPLLEI
EPGQYLAESNAILVYLSEGTEFLPYDRFLRAQVLQWLFFEQYSHEPFIATSRFWISILGK
AEEYHEAIKQKSEPGYAALKVMENHLKSHTFFVAERYTIADIALFAYTHVADEGGFDLTQ
FPAIQAWIERVKAESRHITITQEV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgctgcgcttgtacgattttttactttcaggtaattgttataaaatacgtctt
ctattgacacaaatgggtatgccctttgagagggtagaagttaacatcatcaacggcgag
actcgaacaacagaatttttcagcaaaaatcccaacgggaaagttcccctgttggaaatt
gaaccagggcaatacttggcagaatccaacgctattttggtgtatctgagtgaaggcacc
gaatttttaccctatgaccgctttttacgagcgcaagtattgcaatggttattttttgag
cagtacagccatgaacctttcatcgctacatcaagattttggatttctattttaggtaag
gctgaagaatatcatgaagccatcaagcaaaaaagtgaaccgggttatgcagcacttaaa
gtgatggaaaaccatttaaaatctcacactttttttgtggcggagcgttatactatcgcc
gatatcgccttgtttgcttacactcatgtagccgatgagggtggatttgatttgacacaa
tttcccgctattcaagcttggatagaacgagtcaaagctgagtcgagacatatcactatt
actcaggaagtttaa

DBGET integrated database retrieval system