KEGG   Cylindrospermum stagnale: Cylst_0482Help
Entry
Cylst_0482        CDS       T02398                                 

Definition
hypothetical protein, contains double-stranded beta-helix domain
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
csg  Cylindrospermum stagnale
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cylst_0482
Enzymes [BR:csg01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Cylst_0482
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Cylst_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
524986..525540
Genome map
AA seq 184 aa AA seqDB search
MATLLLDDGTIETELSEIVRELEPLGIHLSHYDPGTSLLFPNLLDQDLVTESEKRYILGL
HNSVFEFLQQENGYLWCDLQSVHPGSPNLQTQITTYSQYHTHTTAEPIYVLAGEMIYGFV
RPDGSHVQLLLQAQDYLHIRAGVEHWCSPSASLHFKAIRYFTNAEGWMPHYTGTQLSDSL
NKPR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcgactttattacttgacgacggcaccattgagactgagttaagcgagatagttcgt
gaacttgaacccctcggcatccacctaagccattacgaccccggaacatctctcctgttc
cccaacttgctagatcaagatcttgtcacagagtctgaaaagcgttatattttgggactc
cataacagcgtctttgaattcctgcaacaagaaaacggttatctctggtgtgatttgcag
agtgtacatccaggttcgccaaatctccaaacgcagatcacgacttatagccagtatcat
actcacaccactgccgaaccaatctacgtattagcaggagagatgatctatggcttcgtg
cgaccagatggtagtcacgtacagcttttgcttcaggcacaagactatctccacattaga
gccggtgtagagcattggtgtagtccttcggcatctttgcatttcaaagcgatccgttat
ttcacaaatgcagaaggttggatgccacattacacaggaactcagttgagtgattctctc
aacaaacctcgctaa

DBGET integrated database retrieval system